PRLHR Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PRLHR Polyclonal antibody, PBS Only (24800-1-PBS)

• 

  WB analysis using 24800-1-AP (same clone as 24800-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 24800-1-AP (PRLHR antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24800-1-PBS in a different storage buffer formulation.

PRLHR Polyclonal Antibody for WB, Indirect ELISA

Cat No. 24800-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

24800-1-PBS targets PRLHR in WB, Indirect ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20098

  Product name: Recombinant human PRLHR protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-73 aa of BC101490

  Sequence: MASSTTRGPRVSDLFSGLPPAVTTPANQSAEASAGNGSVAGADAPAVTPFQSLQLVHQLKGLIVLLYSVVVVV

• Full Name: prolactin releasing hormone receptor
• Calculated Molecular Weight: 370 aa, 41 kDa
• Observed Molecular Weight: 41 kDa
• GenBank Accession Number: BC101490
• Gene Symbol: PRLHR
• Gene ID (NCBI): 2834
• RRID: AB_3669450
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P49683
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PRLHR (prolactin-releasing hormone receptor) is implicated in lactation, regulation of food intake, and pain-signal processing.