PRLR Monoclonal antibody, PBS Only

• 

  WB analysis using 67292-1-Ig (same clone as 67292-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67292-1-Ig (PRLR antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67292-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A431 using 67292-1-Ig (same clone as 67292-1-PBS)

  A431 cells were subjected to SDS PAGE followed by western blot with 67292-1-Ig (PRLR antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67292-1-PBS in a different storage buffer formulation.

• 

  WB analysis of T-47D using 67292-1-Ig (same clone as 67292-1-PBS)

  T-47D cells were subjected to SDS PAGE followed by western blot with 67292-1-Ig (PRLR antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67292-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 67292-1-Ig (same clone as 67292-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67292-1-Ig (PRLR antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67292-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 67292-1-Ig (same clone as 67292-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67292-1-Ig (PRLR antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67292-1-PBS in a different storage buffer formulation.

PRLR Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 67292-1-PBS

Clone No.2E10G5

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

2E10G5, hPRLrI, PRL R, PRL-R, prolactin receptor

---

Product Information

67292-1-PBS targets PRLR in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28778

  Product name: Recombinant human PRLR protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 290-622 aa of BC059392

  Sequence: EELLSALGCQDFPPTSDYEDLLVEYLEVDDSEDQHLMSVHSKEHPSQGMKPTYLDPDTDSGRGSCDSPSLLSEKCEEPQANPSTFYDPEVIEKPENPETTHTWDPQCISMEGKIPYFHAGGSKCSTWPLPQPSQHNPRSSYHNITDVCELAVGPAGAPATLLNEAGKDALKSSQTIKSREEGKATQQREVESFHSETDQDTPWLLPQEKTPFGSAKPLDYVEIHKVNKDGALSLLPKQRENSGKPKKPGTPENNKEYAKVSGVMDNNILVLVPDPHAKNVACFEESAKEAPPSLEQNQAEKALANFTATSSKCRLQLGGLDYLDPACFTHSFH

• Full Name: prolactin receptor
• Calculated Molecular Weight: 622 aa, 70 kDa
• Observed Molecular Weight: 45 kDa, 70 kDa, 85-95 kDa
• GenBank Accession Number: BC059392
• Gene Symbol: PRLR
• Gene ID (NCBI): 5618
• RRID: AB_2882557
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P16471
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PRLR belongs to the cytokine type I subfamily, which also includes receptors for leptin, leukemia inhibiting factor, erythropoietin and so on. PRLR has long and short forms at approximately 70 and 45 kDa, respectively, and the mature, glycosylated form of PRLR migrates at 85-95 kDa in human decidua and placenta (PMID: 18258683).