PRMT2 Monoclonal antibody, PBS Only

• 

  WB analysis of SKOV-3 using 66885-1-Ig (same clone as 66885-1-PBS)

  SKOV-3 cells were subjected to SDS PAGE followed by western blot with 66885-1-Ig (PRMT2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66885-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat heart using 66885-1-Ig (same clone as 66885-1-PBS)

  rat heart tissue were subjected to SDS PAGE followed by western blot with 66885-1-Ig (PRMT2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66885-1-PBS in a different storage buffer formulation.

• 

  WB analysis of LNCaP using 66885-1-Ig (same clone as 66885-1-PBS)

  LNCaP cells were subjected to SDS PAGE followed by western blot with 66885-1-Ig (PRMT2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66885-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 66885-1-Ig (same clone as 66885-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 66885-1-Ig (PRMT2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66885-1-PBS in a different storage buffer formulation.

• 

  WB analysis of 4T1 using 66885-1-Ig (same clone as 66885-1-PBS)

  4T1 cells were subjected to SDS PAGE followed by western blot with 66885-1-Ig (PRMT2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66885-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 66885-1-Ig (same clone as 66885-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 66885-1-Ig (PRMT2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66885-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human thyroid cancer using 66885-1-Ig (same clone as 66885-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 66885-1-Ig (PRMT2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66885-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human thyroid cancer using 66885-1-Ig (same clone as 66885-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 66885-1-Ig (PRMT2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66885-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 66885-1-Ig (same clone as 66885-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using PRMT2 antibody (66885-1-Ig, Clone: 1F1B9 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66885-1-PBS in a different storage buffer formulation.

PRMT2 Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 66885-1-PBS

Clone No.1F1B9

Host / Isotype

Mouse / IgG2a

Reactivity

Human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

HMT1, HRMT1L1, PRMT2

---

Product Information

66885-1-PBS targets PRMT2 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1806

  Product name: Recombinant human PRMT2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 134-433 aa of BC000727

  Sequence: ESLTDKVILDVGCGTGIISLFCAHYARPRAVYAVEASEMAQHTGQLVLQNGFADIITVYQQKVEDVVLPEKVDVLVSEWMGTCLLFEFMIESILYARDAWLKEDGVIWPTMAALHLVPCSADKDYRSKVLFWDNAYEFNLSALKSLAVKEFFSKPKYNHILKPEDCLSEPCTILQLDMRTVQISDLETLRGELRFDIRKAGTLHGFTAWFSVHFQSLQEGQPPQVLSTGPFHPTTHWKQTLFMMDDPVPVHTGDVVTGSVVLQRNPVWIRHMSVALSWAVTSRQDPTSQKVGEKVFPIWR

• Full Name: protein arginine methyltransferase 2
• Calculated Molecular Weight: 49 kDa
• Observed Molecular Weight: 45-50 kDa
• GenBank Accession Number: BC000727
• Gene Symbol: PRMT2
• Gene ID (NCBI): 3275
• RRID: AB_2882217
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P55345
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PRMT2 (also known as HRMT1L1) is a member of the arginine methyltransferase family which catalyzes arginine methylation and regulates diverse cellular processes, including transcription, translation, DNA repair, and RNA processing. Recently PRMT2 has been identified as a pro-tumorigenic factor in malignant gliomas.