PRMT2 Monoclonal antibody

• Home
• Products
• Primary Antibodies
• PRMT2 Monoclonal antibody (66885-1-Ig)

PRMT2 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 66885-1-Ig Copied!

Clone No. 1F1B9

Publications (10)

Download datasheet

Host / Isotype

Mouse / IgG2a

Reactivity

Human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

HMT1, HRMT1L1, PRMT2

• 

  WB analysis of SKOV-3 using 66885-1-Ig

  SKOV-3 cells were subjected to SDS PAGE followed by western blot with 66885-1-Ig (PRMT2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat heart using 66885-1-Ig

  rat heart tissue were subjected to SDS PAGE followed by western blot with 66885-1-Ig (PRMT2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of LNCaP using 66885-1-Ig

  LNCaP cells were subjected to SDS PAGE followed by western blot with 66885-1-Ig (PRMT2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Jurkat using 66885-1-Ig

  Jurkat cells were subjected to SDS PAGE followed by western blot with 66885-1-Ig (PRMT2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of 4T1 using 66885-1-Ig

  4T1 cells were subjected to SDS PAGE followed by western blot with 66885-1-Ig (PRMT2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 66885-1-Ig

  HeLa cells were subjected to SDS PAGE followed by western blot with 66885-1-Ig (PRMT2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human thyroid cancer using 66885-1-Ig

  Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 66885-1-Ig (PRMT2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human thyroid cancer using 66885-1-Ig

  Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 66885-1-Ig (PRMT2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 66885-1-Ig

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using PRMT2 antibody (66885-1-Ig, Clone: 1F1B9 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for PRMT2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: SKOV-3 cells, HeLa cells, rat heart tissue, LNCaP cells, Jurkat cells, 4T1 cells
• Positive IHC detected in: human thyroid cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

66885-1-Ig targets PRMT2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1806

  Product name: Recombinant human PRMT2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 134-433 aa of BC000727

  Sequence: ESLTDKVILDVGCGTGIISLFCAHYARPRAVYAVEASEMAQHTGQLVLQNGFADIITVYQQKVEDVVLPEKVDVLVSEWMGTCLLFEFMIESILYARDAWLKEDGVIWPTMAALHLVPCSADKDYRSKVLFWDNAYEFNLSALKSLAVKEFFSKPKYNHILKPEDCLSEPCTILQLDMRTVQISDLETLRGELRFDIRKAGTLHGFTAWFSVHFQSLQEGQPPQVLSTGPFHPTTHWKQTLFMMDDPVPVHTGDVVTGSVVLQRNPVWIRHMSVALSWAVTSRQDPTSQKVGEKVFPIWR

• Full Name: protein arginine methyltransferase 2
• Calculated Molecular Weight: 49 kDa
• Observed Molecular Weight: 45-50 kDa
• GenBank Accession Number: BC000727
• Gene Symbol: PRMT2
• Gene ID (NCBI): 3275
• RRID: AB_2882217
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P55345
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PRMT2 (also known as HRMT1L1) is a member of the arginine methyltransferase family which catalyzes arginine methylation and regulates diverse cellular processes, including transcription, translation, DNA repair, and RNA processing. Recently PRMT2 has been identified as a pro-tumorigenic factor in malignant gliomas.

Publications

What published studies show

Anti-PRMT2 antibody (Cat# 66885-1-Ig) has 10 citations across journals including Cell Death & Disease, Cell Reports, Brain Behavior and Immunity, Biochemical Pharmacology, Neurochemistry International, ACS Omega, and Toxicology and Applied Pharmacology. Research fields span oncology (renal cell carcinoma, AML, hepatocellular carcinoma, sarcoma), neuroscience (neuropathic pain, ischemic brain injury, neuroinflammation, depression), and protein arginine methylation biology. Applications are predominantly Western blot and IHC in human, mouse, and rat samples.

Automatically generated from the 10 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC	Cell Death Dis; PRMT2 promotes RCC tumorigenesis and metastasis via enhancing WNT5A transcriptional expression; Authors - Zhongwei Li
rat	WB	Cell Rep; PRMT2-mediated upregulation of miR-323-3p in sensory neurons promotes trigeminal neuropathic pain by targeting Kv2.1 channels.; Authors - Renfei Qi
mouse	WB	Brain Behav Immun; Microglial PRMT2IP alleviates ischemia-induced brain injury.; Authors - Min Zhang ; KD Validated
		Br J Pharmacol; The role of protein arginine methyltransferases in sickle cell-mediated neurovascular impairments in mice.; Authors - Julia Zaccarelli-Magalhães
human	WB	Biochem Pharmacol; A novel 3-alkenylindol-2-one derivative selectively inhibits the growth of acute myeloid leukemia via modulation of the MYC-PRMT pathway; Authors - Shuhong Dong
human	WB	Int J Mol Sci; Human C15orf39 Inhibits Inflammatory Response via PRMT2 in Human Microglial HMC3 Cell Line; Authors - Min Zhang