PRMT3 Recombinant monoclonal antibody

• 

  WB analysis using 83969-6-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 83969-6-RR (PRMT3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse liver using 83969-6-RR

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 83969-6-RR (PRMT3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 83969-6-RR

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using PRMT3 antibody (83969-6-RR, Clone: 241092H2 ) at dilution of 1:250 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• 

  FC experiment of MCF-7 using 83969-6-RR

  1x10^6 MCF-7 cells were intracellularly stained with 0.25 ug PRMT3 Recombinant antibody (83969-6-RR, Clone:241092H2) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

PRMT3 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA

Cat No. 83969-6-RR

Clone No.241092H2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

Synonyms

241092H2, EC:2.1.1.319, Heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 3, HRMT1L3, PRMT 3

---

Tested Applications

• Positive WB detected in: HepG2 cells, HuH-7 cells, SW480 cells, HEK-293 cells
• Positive IHC detected in: mouse liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells
• Positive FC (Intra) detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

83969-6-RR targets PRMT3 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag13466

  Product name: Recombinant human PRMT3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 178-531 aa of BC037544

  Sequence: RAREDLQKMKQFAQDFVMHTDVRTCSSSTSVIADLQEDEDGVYFSSYGHYGIHEEMLKDKIRTESYRDFIYQNPHIFKDKVVLDVGCGTGILSMFAAKAGAKKVLGVDQSEILYQAMDIIRLNKLEDTITLIKGKIEEVHLPVEKVDVIISEWMGYFLLFESMLDSVLYAKNKYLAKGGSVYPDICTISLVAVSDVNKHADRIAFWDDVYGFKMSCMKKAVIPEAVVEVLDPKTLISEPCGIKHIDCHTTSISDLEFSSDFTLKITRTSMCTAIAGYFDIYFEKNCHNRVVFSTGPQSTKTHWKQTVFLLEKPFSVKAGEALKGKVTVHKNKKDPRSLTVTLTLNNSTQTYGLQ

• Full Name: protein arginine methyltransferase 3
• Calculated Molecular Weight: 531 aa, 60 kDa
• Observed Molecular Weight: 60-68 kDa
• GenBank Accession Number: BC037544
• Gene Symbol: PRMT3
• Gene ID (NCBI): 10196
• RRID: AB_3671545
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: O60678
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PRMT3(protein arginine methyltransferase 3) regulates protein functions by introducing asymmetric dimethylation marks at the arginine residues in proteins.