PRODH Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PRODH Polyclonal antibody, PBS Only (22980-1-PBS)

• 

  WB analysis using 22980-1-AP (same clone as 22980-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 22980-1-AP (PRODH antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22980-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 22980-1-AP (same clone as 22980-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 22980-1-AP (PRODH antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22980-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 22980-1-AP (same clone as 22980-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 22980-1-AP (PRODH antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22980-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human cerebellum using 22980-1-AP (same clone as 22980-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human cerebellum slide using 22980-1-AP (PRODH Antibody) at dilution of 1:50(under 10x lens). This data was developed using the same antibody clone with 22980-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human cerebellum using 22980-1-AP (same clone as 22980-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human cerebellum slide using 22980-1-AP (PRODH Antibody) at dilution of 1:50(under 40x lens). This data was developed using the same antibody clone with 22980-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 22980-1-AP (same clone as 22980-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 22980-1-AP (PRODH antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22980-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 22980-1-AP (same clone as 22980-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 22980-1-AP (PRODH antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22980-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 22980-1-AP (same clone as 22980-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 22980-1-AP (PRODH antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22980-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 22980-1-AP (same clone as 22980-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 22980-1-AP (PRODH antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22980-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 22980-1-AP (same clone as 22980-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 22980-1-AP (PRODH antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22980-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 22980-1-AP (same clone as 22980-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 22980-1-AP (PRODH antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22980-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skeletal muscle using 22980-1-AP (same clone as 22980-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle slide using 22980-1-AP (PRODH Antibody) at dilution of 1:50(under 10x lens). This data was developed using the same antibody clone with 22980-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skeletal muscle using 22980-1-AP (same clone as 22980-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle slide using 22980-1-AP (PRODH Antibody) at dilution of 1:50(under 40x lens). This data was developed using the same antibody clone with 22980-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

PRODH Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 22980-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

22980-1-PBS targets PRODH in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18429

  Product name: Recombinant human PRODH protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 143-492 aa of BC118597

  Sequence: LAKWRCFFHQMAVEQGQAGLAAMDTKLEVAVLQESVAKLGIASRAEIEDWFTAETLGVSGTMDLLDWSSLIDSRTKLSKHLVVPNAQTGQLEPLLSRFTEEEELQMTRMLQRMDVLAKKATEMGVRLMVDAEQTYFQPAISRLTLEMQRKFNVEKPLIFNTYQCYLKDAYDNVTLDVELARREGWCFGAKLVRGAYLAQERARAAEIGYEDPINPTYEATNAMYHRCLDYVLEELKHNAKAKVMVASHNEDTVRFALRRMEELGLHPADHRVYFGQLLGMCDQISFPLGQAGYPVYKYVPYGPVMEVLPYLSRRALENSSLMKGTHRERQLLWLELLRRLRTGNLFHRPA

• Full Name: proline dehydrogenase (oxidase) 1
• Calculated Molecular Weight: 600 aa, 68 kDa
• Observed Molecular Weight: 56 kDa, 66 kDa
• GenBank Accession Number: BC118597
• Gene Symbol: PRODH
• Gene ID (NCBI): 5625
• RRID: AB_2879191
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43272
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PRODH(Proline dehydrogenase 1, mitochondrial) is also named as PIG6, HSPOX2, PRODH1, PRODH2, POX, SCZD4, TP53I6 and belongs to the proline oxidase family. It is an oxidoreductase involved in the transfer of redox potential across the mitochondrial membrane and catalyzes the rate-limiting oxidation of proline to pyrroline- 5-carboxylate (P5C). High PRODH activity is sufficient to induce mitochondria-mediated apoptosis in the presence of proline. Defects in PRODH are the cause of hyperprolinemia type 1 (HP-1) and defects in PRODH are associated with susceptibility to schizophrenia type 4 (SCZD4). This protein has 3 isoforms produced by alternative splicing with the molecular mass of 68 kDa, 59 kDa and 56 kDa.