PROKR1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PROKR1 Polyclonal antibody, PBS Only (21367-1-PBS)

• 

  WB analysis using 21367-1-AP (same clone as 21367-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 21367-1-AP (PROKR1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21367-1-PBS in a different storage buffer formulation.

PROKR1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 21367-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

G protein coupled receptor 73, G protein coupled receptor ZAQ, GPR73, GPR73a, PK R1

---

Product Information

21367-1-PBS targets PROKR1 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15838

  Product name: Recombinant human PROKR1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-50 aa of BC100960

  Sequence: METTMGFMDDNATNTSTSFLSVLNPHGAHATSFPFNFSYSDYDMPLDEDE

• Full Name: prokineticin receptor 1
• Calculated Molecular Weight: 393 aa, 45 kDa
• Observed Molecular Weight: 48 kDa
• GenBank Accession Number: BC100960
• Gene Symbol: PROKR1
• Gene ID (NCBI): 10887
• RRID: AB_3742031
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8TCW9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PROKR1, also named as GPR73, PKR1 and PK-R1, belongs to the G-protein coupled receptor 1 family. It is a receptor for prokineticin 1. PROKR1 exclusively coupled to the G(q) subclass of heteromeric G proteins.