PROSER1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PROSER1 Polyclonal antibody (31494-1-AP)

• 

  IP experiment of Jurkat using 31494-1-AP

  IP result of anti-C13orf23 (IP:31494-1-AP, 4ug; Detection:31494-1-AP 1:500) with Jurkat cells lysate 1800 ug.

• 

  IHC staining of human ovary tumor using 31494-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 31494-1-AP (C13orf23 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of U2OS using 31494-1-AP

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using PROSER1 antibody (31494-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

PROSER1 Polyclonal Antibody for IHC, IF/ICC, IP, ELISA

Cat No. 31494-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, IF/ICC, IP, ELISA

Synonyms

C13orf23, bA50D16.2, KIAA2032, Proline And Serine Rich 1, Proline and serine-rich protein 1

---

Tested Applications

• Positive IP detected in: Jurkat cells
• Positive IHC detected in: human ovary tumor tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: U2OS cells

Recommended dilution

• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31494-1-AP targets PROSER1 in IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35678

  Product name: Recombinant human C13orf23 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-178 aa of NM_025138.4

  Sequence: MDKKSFEMVLDEIRKAVLTEYKLKAIEYVHGYFSSEQVVDLLRYFSWAEPQLKAMKALQHKMVAVQPTEVVNILNCFTFSKDKLVALELLASNIIDAQNSRPIEDLFRVNMSEKKRCKRILEQAFKGGCKAPHAMISSCGTIPGNPYPKGRPSRINGIFPGTPLKKDGEECTNEGKGI

• Full Name: chromosome 13 open reading frame 23
• Calculated Molecular Weight: 96kDa，944aa
• Observed Molecular Weight: 100 kDa
• GenBank Accession Number: NM_025138.4
• Gene Symbol: C13orf23
• Gene ID (NCBI): 80209
• RRID: AB_3742438
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q86XN7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PROSER1 (proline- and serine-rich 1) is a chromatin-binding protein encoded by the 13q13.3 locus. It interacts with all three TET enzymes and serves as the core scaffold of the TOPD (TET‑OGT‑PROSER1‑DBHS) complex, stabilizing the binding between TET2 and OGT while promoting O‑GlcNAcylation, thereby enhancing DNA demethylation activity. PROSER1 has recently been found to be associated with neurodevelopmental disorders.