PROSER1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PROSER1 Polyclonal antibody, PBS Only (31494-1-PBS)

• 

  IP experiment of Jurkat using 31494-1-AP (same clone as 31494-1-PBS)

  IP result of anti-C13orf23 (IP:31494-1-AP, 4ug; Detection:31494-1-AP 1:500) with Jurkat cells lysate 1800 ug. This data was developed using the same antibody clone with 31494-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 31494-1-AP (same clone as 31494-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 31494-1-AP (C13orf23 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31494-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U2OS using 31494-1-AP (same clone as 31494-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using PROSER1 antibody (31494-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 31494-1-PBS in a different storage buffer formulation.

PROSER1 Polyclonal Antibody for IHC, IF/ICC, IP, Indirect ELISA

Cat No. 31494-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, IF/ICC, IP, Indirect ELISA

Synonyms

C13orf23, bA50D16.2, KIAA2032, Proline And Serine Rich 1, Proline and serine-rich protein 1

---

Product Information

31494-1-PBS targets PROSER1 in IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35678

  Product name: Recombinant human C13orf23 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-178 aa of NM_025138.4

  Sequence: MDKKSFEMVLDEIRKAVLTEYKLKAIEYVHGYFSSEQVVDLLRYFSWAEPQLKAMKALQHKMVAVQPTEVVNILNCFTFSKDKLVALELLASNIIDAQNSRPIEDLFRVNMSEKKRCKRILEQAFKGGCKAPHAMISSCGTIPGNPYPKGRPSRINGIFPGTPLKKDGEECTNEGKGI

• Full Name: chromosome 13 open reading frame 23
• Calculated Molecular Weight: 96kDa，944aa
• Observed Molecular Weight: 100 kDa
• GenBank Accession Number: NM_025138.4
• Gene Symbol: C13orf23
• Gene ID (NCBI): 80209
• RRID: AB_3742438
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q86XN7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PROSER1 (proline- and serine-rich 1) is a chromatin-binding protein encoded by the 13q13.3 locus. It interacts with all three TET enzymes and serves as the core scaffold of the TOPD (TET‑OGT‑PROSER1‑DBHS) complex, stabilizing the binding between TET2 and OGT while promoting O‑GlcNAcylation, thereby enhancing DNA demethylation activity. PROSER1 has recently been found to be associated with neurodevelopmental disorders.