PRPF39 Polyclonal antibody

• 

  WB analysis of K-562 using 24480-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 24480-1-AP (PRPF39 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Raji using 24480-1-AP

  Raji cells were subjected to SDS PAGE followed by western blot with 24480-1-AP (PRPF39 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of COLO 320 using 24480-1-AP

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 24480-1-AP (PRPF39 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human testis using 24480-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 24480-1-AP (PRPF39 Antibody) at dilution of 1:400 (under 40x lens).

• 

  IHC staining of human testis using 24480-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 24480-1-AP (PRPF39 Antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human testis using 24480-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 24480-1-AP (PRPF39 Antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human testis using 24480-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 24480-1-AP (PRPF39 Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human testis using 24480-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 24480-1-AP (PRPF39 Antibody) at dilution of 1:200 (under 40x lens).

• 

  IHC staining of human testis using 24480-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 24480-1-AP (PRPF39 Antibody) at dilution of 1:400 (under 10x lens).

PRPF39 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 24480-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

Pre mRNA processing factor 39, PRP39 homolog, PRPF39

---

Tested Applications

• Positive WB detected in: K-562 cells, COLO 320 cells, Raji cells
• Positive IHC detected in: human testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

24480-1-AP targets PRPF39 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21683

  Product name: Recombinant human PRPF39 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-348 aa of BC125126

  Sequence: MEQSPDDSPNVNASTEETEMASAVDLPVTLTETEANFPPEYEKFWKTVENNPQDFTGWVYLLQYVEQENHLMAARKAFDRFFIHYPYCYGYWKKYADLEKRHDNIKPSDEVYRRGLQAIPLSVDLWIHYINFLKETLDPGDPETNNTIRGTFEHAVLAAGTDFRSDRLWEMYINWENEQGNLREVTAIYDRILGIPTQLYSHHFQRFKEHVQNNLPRDLLTGEQFIQLRRELASVNGHSGDDGPPGDDLPSGIEDITDPAKLITEIENMRHRIIEIHQEMFNYNEHEVSKRWTFEEGIKRPYFHVKPLEKAQLKNWKEYLEFEIENGTHERVVVLFERCVISCALYEE

• Full Name: PRP39 pre-mRNA processing factor 39 homolog (S. cerevisiae)
• Calculated Molecular Weight: 669 aa, 78 kDa
• Observed Molecular Weight: 75-85 kDa
• GenBank Accession Number: BC125126
• Gene Symbol: PRPF39
• Gene ID (NCBI): 55015
• RRID: AB_2879563
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86UA1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PRPF39 also termed as Pre mRNA processing factor 39 or PRP39 homolog is a 669 amino acid protein, which contains 7 HAT repeats and belongs to the PRP39 family. PRPF39 localizes in nucleus and may play a role in mRNA splicing.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Discov Oncol; Prognostic implications of alternative splicing events and key splicing factors in head and neck squamous cell carcinoma; Authors - Siyi He