PRPS1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PRPS1 Polyclonal antibody (15549-1-AP)

PRPS1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 15549-1-AP Copied!

Publications (23)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Synonyms

PRS I, PPRibP, KIAA0967, EC:2.7.6.1, CMTX5

• 

  WB analysis using 15549-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15549-1-AP (PRPS1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat spleen using 15549-1-AP

  rat spleen tissue were subjected to SDS PAGE followed by western blot with 15549-1-AP (PRPS1 Antibody) at dilution of 1:100 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HeLa using 15549-1-AP

  IP result of anti-PRPS1 (IP:15549-1-AP, 4ug; Detection:15549-1-AP 1:2000) with HeLa cells lysate 1600 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse testis using 15549-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 15549-1-AP (PRPS1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse testis using 15549-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 15549-1-AP (PRPS1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of U-251 using 15549-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed U-251 cells using PRPS1 antibody (15549-1-AP) at dilution of 1:200 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for PRPS1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293 cells, rat spleen tissue, HeLa cells, Jurkat cells, mouse kidney tissue, rat kidney tissue
• Positive IP detected in: HeLa cells
• Positive IHC detected in: mouse testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: U-251 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15549-1-AP targets PRPS1 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7907

  Product name: Recombinant human PRPS1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-318 aa of BC001605

  Sequence: MPNIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIRENISEWRNCTIVSPDAGGAKRVTSIADRLNVDFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLFSHVPL

• Full Name: phosphoribosyl pyrophosphate synthetase 1
• Calculated Molecular Weight: 318 aa, 35 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC001605
• Gene Symbol: PRPS1
• Gene ID (NCBI): 5631
• RRID: AB_10694269
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P60891
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PRPS1, also named as Ribose-phosphate pyrophosphokinase 1, is a 318 amino acid protein, which belongs to the ribose-phosphate pyrophosphokinase family. PRPS1 can form Homodimer and the active form is probably a hexamer composed of 3 homodimers. PRPS1 catalyzes the synthesis of phosphoribosylpyrophosphate (PRPP) which is essential for nucleotide synthesis. PRPS1 as a module has an association with the Hepatocellular carcinoma.

Publications

What published studies show

The PRPS1 Polyclonal antibody (Cat# 15549-1-AP) has 23 citations across journals including Science, Cell, Nature Metabolism, Nature Communications, Molecular Cell, Nature Chemical Biology, Science Advances, Cell Death & Differentiation, Frontiers in Immunology, Oncotarget, and bioRxiv. Research fields span purine/nucleotide biosynthesis, metabolic reprogramming, mitochondrial function, energy stress, cancer (melanoma, leukemia, lymphoma, hepatocellular carcinoma), redox homeostasis, drug resistance, and Alzheimer's disease.

Automatically generated from the 23 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	WB	Science; NUDT5 regulates purine metabolism and thiopurine sensitivity by interacting with PPAT; Authors - Zheng Wu
		Science; mTORC1 induces purine synthesis through control of the mitochondrial tetrahydrofolate cycle.; Authors - Issam Ben-Sahra
human,mouse	WB	Cell; De novo and salvage purine synthesis pathways across tissues and tumors; Authors - Diem H Tran
human	WB	Nat Metab; Mitochondrial NADP+ is essential for proline biosynthesis during cell growth.; Authors - Diem H Tran
mouse	WB	Nat Commun; The role of gene duplication and paralog specialisation in the evolution of the mammalian PRPS complex; Authors - Bibek R Karki ; KO Validated
human	WB	Nat Commun; Identification of purine biosynthesis as an NADH-sensing pathway to mediate energy stress; Authors - Ronghui Yang ; KD Validated