Trypsin 2/PRSS2 Polyclonal antibody

• 

  WB analysis of Raji using 15005-1-AP

  Raji cells were subjected to SDS PAGE followed by western blot with 15005-1-AP (PRSS2 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 15005-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 15005-1-AP (PRSS2 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse thymus using 15005-1-AP

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 15005-1-AP (PRSS2 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human small intestine using 15005-1-AP

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 15005-1-AP (PRSS2 Antibody) at dilution of 1:400 (under 10x lens).

• 

  IHC staining of human small intestine using 15005-1-AP

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 15005-1-AP (PRSS2 Antibody) at dilution of 1:400 (under 40x lens).

• Featured Product
• KD/KO Validated

Trypsin 2/PRSS2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 15005-1-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

PRSS2, Trypsin-2, TRYP2, TRY2, EC:3.4.21.4

---

Tested Applications

• Positive WB detected in: Raji cells, HepG2 cells, mouse thymus tissue
• Positive IHC detected in: human small intestine tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 3 publications below
• IHC: See 2 publications below

Product Information

15005-1-AP targets Trypsin 2/PRSS2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6461

  Product name: Recombinant human PRSS2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-239 aa of BC030260

  Sequence: MNLLLILTFVAAAVAAPFDDDDKIVGGYICEENSVPYQVSLNSGYHFCGGSLISEQWVVSAGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPKYNSRTLDNDILLIKLSSPAVINSRVSAISLPTAPPAAGTESLISGWGNTLSSGADYPDELQCLDAPVLSQAECEASYPGKITNNMFCVGFLEGGKDSCQGDSGGPVVSNGELQGIVSWGYGCAQKNRPGVYTKVYNYVDWI

• Full Name: protease, serine, 2 (trypsin 2)
• Calculated Molecular Weight: 26 kDa
• Observed Molecular Weight: 26 kDa, 35 kDa
• GenBank Accession Number: BC030260
• Gene Symbol: PRSS2
• Gene ID (NCBI): 5645
• RRID: AB_2171841
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P07478
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The human pancreas produces three isoforms of trypsinogen encoded by separate genes, the PRSS1 (protease, serine 1), PRSS2, and PRSS3 genes. PRSS2 is also named as TRY2(trypsin-2), TRYP2. In the ileum, it may be involved in defensin processing, including DEFA5. The preproprotein comprises 247 amino acids, including a 15-amino acid signal peptide and an 8-amino acid activation peptide.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Biol Open; Exocrine pancreas proteases regulate β-cell proliferation in zebrafish ciliopathy models and in murine systems.; Authors - Timothy L Hostelley
human,mouse	WB,IHC	Tissue Cell; PRSS2 overexpression relates to poor prognosis and promotes proliferation, migration and invasion in gastric cancer; Authors - Yu Chen ; KD Validated
mouse	IHC	Biochem Biophys Res Commun; Epigenome-wide association analysis of pancreatic exocrine cells from high-fat- and normal diet-fed mice and its potential use for understanding the oncogenesis of human pancreatic cancer; Authors - Tomoyuki Araki
human	WB	Acta Histochem; PRSS2 regulates EMT and metastasis via MMP-9 in gastric cancer; Authors - Fei Wang ; KD Validated