PRY Polyclonal antibody

• 

  WB analysis of human testis using 24688-1-AP

  human testis tissue were subjected to SDS PAGE followed by western blot with 24688-1-AP (PRY antibody at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human prostate cancer using 24688-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 24688-1-AP (PRY antibody at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human prostate cancer using 24688-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 24688-1-AP (PRY antibody at dilution of 1:200 (under 40x lens).

• 

  IF Staining of PC-3 using 24688-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed PC-3 cells using PRY antibody (24688-1-AP) at dilution of 1:400 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4).

PRY Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 24688-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

PRY2, PRY1, PRYP3, PRYP4, PTPN13 like protein, Y linked

---

Tested Applications

• Positive WB detected in: human testis tissue
• Positive IHC detected in: human prostate cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: PC-3 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24688-1-AP targets PRY in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20232

  Product name: Recombinant human PRY2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-63 aa of BC153128

  Sequence: MGATGLGFLLSWRQDNLNGTDCQGCNILYFSETTGSMCSELSLNRGLEARRKKDLKDSFLWRY

• Full Name: PTPN13-like, Y-linked 2
• Calculated Molecular Weight: 147 aa, 17 kDa
• Observed Molecular Weight: 7 kDa
• GenBank Accession Number: BC153128
• Gene Symbol: PRY
• Gene ID (NCBI): 442862
• RRID: AB_2879672
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O14603
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PRY is Testis-specific PTP-BL-related Y protein which has two isoforms with MW 16 and 6-8 kDa.