Use Able AI chat for product recommendations

PSAT1 Monoclonal antibody

PSAT1 Monoclonal Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA

Cat No. 67619-1-Ig
Clone No.1B2C9

Host / Isotype

Mouse / IgG1

Reactivity

human, rat, pig and More (1)

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

1B2C9, EC:2.6.1.52, EPIP, Phosphoserine aminotransferase, PSA

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HEK-293 cells, Jurkat cells, K-562 cells, NIH/3T3 cells, pig brain tissue, rabbit brain tissue, rat brain tissue, mouse brain tissue
Positive IHC detected inhuman breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHCT 116 cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:250-1:1000
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67619-1-Ig targets PSAT1 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, rat, pig samples.

Tested Reactivity human, rat, pig
Cited Reactivityhuman, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag14076

Product name: Recombinant human PSAT1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-370 aa of BC001618

Sequence: MDAPRQVVNFGPGPAKLPHSVLLEIQKELLDYKGVGISVLEMSHRSSDFAKIINNTENLVRELLAVPDNYKVIFLQGGGCGQFSAVPLNLIGLKAGRCADYVVTGAWSAKAAEEAKKFGTINIVHPKLGSYTKIPDPSTWNLNPDASYVYYCANETVHGVEFDFIPDVKGAVLVCDMSSNFLSKPVDVSKFGVIFAGAQKNVGSAGVTVVIVRDDLLGFALRECPSVLEYKVQAGNSSLYNTPPCFSIYVMGLVLEWIKNNGGAAAMEKLSSIKSQTIYEIIDNSQGFYVCPVEPQNRSKMNIPFRIGNAKGDDALEKRFLDKALELNMLSLKGHRSVGGIRASLYNAVTIEDVQKLAAFMKKFLEMHQL

Predict reactive species
Full Name phosphoserine aminotransferase 1
Calculated Molecular Weight 370 aa, 40 kDa
Observed Molecular Weight 37-40 kDa
GenBank Accession NumberBC001618
Gene Symbol PSAT1
Gene ID (NCBI) 29968
RRIDAB_2882821
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9Y617
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PSAT1, also named as PSA and PSAT, belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family and SerC subfamily. It catalyzes the reversible conversion of 3-phosphohydroxypyruvate to phosphoserine and of 3-hydroxy-2-oxo-4-phosphonooxybutanoate to phosphohydroxythreonine. PSAT1 represents a new interesting target for CRC therapy. (PMID:18221502) It may be implicated in altered serine metabolism and schizophrenia spectrum conditions. (PMID:20955740 )

Protocols

Product Specific Protocols
FC protocol for PSAT1 antibody 67619-1-IgDownload protocol
IF protocol for PSAT1 antibody 67619-1-IgDownload protocol
IHC protocol for PSAT1 antibody 67619-1-IgDownload protocol
WB protocol for PSAT1 antibody 67619-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle

Autophagy

PSAT1 inhibits mTORC1 activation by preventing Rag heterodimer formation in lung adenocarcinoma

Authors - Yuhan Liu
humanWB,IHC

Thorac Cancer

Exosomal ERBB2IP contributes to tumor growth via elevating PSAT1 expression in non-small cell lung carcinoma

Authors - Xijuan Peng
humanWB

Cancer Metab

Serine starvation suppresses the progression of esophageal cancer by regulating the synthesis of purine nucleotides and NADPH

Authors - Hui Jie
  • KD Validated
humanWB,IF

Int J Biol Sci

Cancer-associated Fibroblast-like Cells Promote Osteosarcoma Metastasis by Upregulation of Phosphoserine Aminotransferase 1 and Activation of the mTOR/S6K Pathway.

Authors - Liwen Feng
  • KD Validated
humanWB

Exp Mol Med

The m6A writer RBM15 drives the growth of triple-negative breast cancer cells through the stimulation of serine and glycine metabolism

Authors - Su Hwan Park
mouseWB

Naunyn Schmiedebergs Arch Pharmacol

Andrographolide blocked the progression of endometriosis by promoting ferroptosis via inhibiting anabolism of serine.

Authors - Wei Ye

Reviews

    4.0 out of 5
Add a review

1 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Hua (Verified Customer) (01-17-2023)

Good antibody, however the actual results are not as good as that showing on the website. I have to use much lower dilution as 1:1000.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Hela, Mouse liver and mouse brain
PSAT1 Antibody Western Blot validation (1:1000 dilution) in Hela, Mouse liver and mouse brain (Cat no:67619-1-Ig)
Loading...
||
New chat

Able

正在加载,请稍候...