Tested Applications
| Positive WB detected in | HeLa cells, HEK-293 cells, Jurkat cells, K-562 cells, NIH/3T3 cells, pig brain tissue, rabbit brain tissue, rat brain tissue, mouse brain tissue |
| Positive IHC detected in | human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HCT 116 cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
67619-1-Ig targets PSAT1 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, rat, pig samples.
| Tested Reactivity | human, rat, pig |
| Cited Reactivity | human, mouse |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14076 Product name: Recombinant human PSAT1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-370 aa of BC001618 Sequence: MDAPRQVVNFGPGPAKLPHSVLLEIQKELLDYKGVGISVLEMSHRSSDFAKIINNTENLVRELLAVPDNYKVIFLQGGGCGQFSAVPLNLIGLKAGRCADYVVTGAWSAKAAEEAKKFGTINIVHPKLGSYTKIPDPSTWNLNPDASYVYYCANETVHGVEFDFIPDVKGAVLVCDMSSNFLSKPVDVSKFGVIFAGAQKNVGSAGVTVVIVRDDLLGFALRECPSVLEYKVQAGNSSLYNTPPCFSIYVMGLVLEWIKNNGGAAAMEKLSSIKSQTIYEIIDNSQGFYVCPVEPQNRSKMNIPFRIGNAKGDDALEKRFLDKALELNMLSLKGHRSVGGIRASLYNAVTIEDVQKLAAFMKKFLEMHQL Predict reactive species |
| Full Name | phosphoserine aminotransferase 1 |
| Calculated Molecular Weight | 370 aa, 40 kDa |
| Observed Molecular Weight | 37-40 kDa |
| GenBank Accession Number | BC001618 |
| Gene Symbol | PSAT1 |
| Gene ID (NCBI) | 29968 |
| RRID | AB_2882821 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q9Y617 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PSAT1, also named as PSA and PSAT, belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family and SerC subfamily. It catalyzes the reversible conversion of 3-phosphohydroxypyruvate to phosphoserine and of 3-hydroxy-2-oxo-4-phosphonooxybutanoate to phosphohydroxythreonine. PSAT1 represents a new interesting target for CRC therapy. (PMID:18221502) It may be implicated in altered serine metabolism and schizophrenia spectrum conditions. (PMID:20955740 )
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for PSAT1 antibody 67619-1-Ig | Download protocol |
| IF protocol for PSAT1 antibody 67619-1-Ig | Download protocol |
| IHC protocol for PSAT1 antibody 67619-1-Ig | Download protocol |
| WB protocol for PSAT1 antibody 67619-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The PSAT1 Monoclonal antibody (Cat# 67619-1-Ig) has 7 citations. These appear in Autophagy, Experimental & Molecular Medicine, International Journal of Biological Sciences, Cancer Metabolism, Naunyn-Schmiedeberg's Archives of Pharmacology, Thoracic Cancer, and Cancer Biotherapy & Radiopharmaceuticals. Research fields span serine/glycine metabolism, mTOR signaling, and cancer biology—including lung adenocarcinoma, triple-negative breast cancer, osteosarcoma, esophageal cancer, non-small cell lung carcinoma, and endometriosis. Applications include WB, IF, and IHC.
| Species | Application | Title |
|---|---|---|
Autophagy PSAT1 inhibits mTORC1 activation by preventing Rag heterodimer formation in lung adenocarcinoma | ||
Exp Mol Med The m6A writer RBM15 drives the growth of triple-negative breast cancer cells through the stimulation of serine and glycine metabolism | ||
Int J Biol Sci Cancer-associated Fibroblast-like Cells Promote Osteosarcoma Metastasis by Upregulation of Phosphoserine Aminotransferase 1 and Activation of the mTOR/S6K Pathway.
| ||
Cancer Metab Serine starvation suppresses the progression of esophageal cancer by regulating the synthesis of purine nucleotides and NADPH
| ||
Naunyn Schmiedebergs Arch Pharmacol Andrographolide blocked the progression of endometriosis by promoting ferroptosis via inhibiting anabolism of serine. | ||
Thorac Cancer Exosomal ERBB2IP contributes to tumor growth via elevating PSAT1 expression in non-small cell lung carcinoma |
Reviews
What customers say
The single review for this antibody (rated 4/5) was for Western Blot on Hela cells, mouse liver, and mouse brain tissue. The reviewer found it a good antibody overall but noted that the actual results were not as strong as those displayed on the website. They also reported needing to use a much lower dilution (1:1000) to achieve acceptable signal, suggesting the recommended dilution may be too high for some applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Hua (Verified Customer) (01-17-2023) | Good antibody, however the actual results are not as good as that showing on the website. I have to use much lower dilution as 1:1000.
 |
