PSENEN Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PSENEN Polyclonal antibody, PBS Only (16144-1-PBS)

• 

  WB analysis using 16144-1-AP (same clone as 16144-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 16144-1-AP (PSENEN antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16144-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 16144-1-AP (same clone as 16144-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 16144-1-AP (PSENEN Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16144-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 16144-1-AP (same clone as 16144-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 16144-1-AP (PSENEN Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16144-1-PBS in a different storage buffer formulation.

PSENEN Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 16144-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

Presenilin enhancer protein 2, PEN2, PEN 2, Gamma-secretase subunit PEN-2, Gamma secretase subunit PEN 2

---

Product Information

16144-1-PBS targets PSENEN in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9243

  Product name: Recombinant human PSENEN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-101 aa of BC009575

  Sequence: MNLERVSNEEKLNLCRKYYLGGFAFLPFLWLVNIFWFFREAFLVPAYTEQSQIKGYVWRSAVGFLFWVIVLTSWITIFQIYRPRWGALGDYLSFTIPLGTP

• Full Name: presenilin enhancer 2 homolog (C. elegans)
• Calculated Molecular Weight: 101 aa, 12 kDa
• Observed Molecular Weight: 12 kDa
• GenBank Accession Number: BC009575
• Gene Symbol: PSENEN
• Gene ID (NCBI): 55851
• RRID: AB_3669231
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NZ42
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PSENEN, also named PEN2, is a component of the gamma-secretase complex, which also includes presenilin (PSEN1) and nicastrin (NCSTN). The gamma-secretase complex is required for the intramembrane proteolysis of a number of membrane proteins, including the amyloid-beta precursor protein (APP) and Notch. PSENEN is required for Notch pathway signaling, and for the activity and accumulation of gamma-secretase. Mutations resulting in haploinsufficiency for this gene cause familial acne inversa-2 (ACNINV2).