Product Information
16144-1-PBS targets PSENEN in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag9243 Product name: Recombinant human PSENEN protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-101 aa of BC009575 Sequence: MNLERVSNEEKLNLCRKYYLGGFAFLPFLWLVNIFWFFREAFLVPAYTEQSQIKGYVWRSAVGFLFWVIVLTSWITIFQIYRPRWGALGDYLSFTIPLGTP Predict reactive species |
| Full Name | presenilin enhancer 2 homolog (C. elegans) |
| Calculated Molecular Weight | 101 aa, 12 kDa |
| Observed Molecular Weight | 12 kDa |
| GenBank Accession Number | BC009575 |
| Gene Symbol | PSENEN |
| Gene ID (NCBI) | 55851 |
| RRID | AB_3669231 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NZ42 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
PSENEN, also named PEN2, is a component of the gamma-secretase complex, which also includes presenilin (PSEN1) and nicastrin (NCSTN). The gamma-secretase complex is required for the intramembrane proteolysis of a number of membrane proteins, including the amyloid-beta precursor protein (APP) and Notch. PSENEN is required for Notch pathway signaling, and for the activity and accumulation of gamma-secretase. Mutations resulting in haploinsufficiency for this gene cause familial acne inversa-2 (ACNINV2).





