PSMA/GCPII Monoclonal antibody, PBS Only (Detector)

• 

  WB analysis of LNCaP using 66678-1-Ig (same clone as 66678-1-PBS)

  LNCaP cells were subjected to SDS PAGE followed by western blot with 66678-1-Ig (FOLH1 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66678-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 66678-1-Ig (same clone as 66678-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66678-1-Ig (PSMA/GCPII antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66678-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat kidney using 66678-1-Ig (same clone as 66678-1-PBS)

  rat kidney tissue were subjected to SDS PAGE followed by western blot with 66678-1-Ig (FOLH1 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66678-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 66678-1-Ig (same clone as 66678-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 66678-1-Ig (PSMA/GCPII antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66678-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 66678-1-Ig (same clone as 66678-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 66678-1-Ig (PSMA/GCPII antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66678-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 66678-1-Ig (same clone as 66678-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 66678-1-Ig (PSMA/GCPII antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66678-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 66678-1-Ig (same clone as 66678-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 66678-1-Ig (PSMA/GCPII antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66678-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 66678-1-Ig (same clone as 66678-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 66678-1-Ig (PSMA/GCPII antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66678-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human prostate cancer using 66678-1-Ig (same clone as 66678-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human prostate cancer tissue using PSMA/GCPII antibody (66678-1-Ig, Clone: 3G4E12 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66678-1-PBS in a different storage buffer formulation.

• 

  IF Staining of LNCaP using 66678-1-Ig (same clone as 66678-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed LNCaP cells using PSMA/GCPII antibody (66678-1-Ig, Clone: 3G4E12 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). This data was developed using the same antibody clone with 66678-1-PBS in a different storage buffer formulation.

• 

  Cytometric bead array standard curve of MP51112-1

  Cytometric bead array standard curve of MP51112-1, PSMA/FOLH1 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 66678-2-PBS. Detection antibody: 66678-1-PBS. Standard:Ag16594. Range: 1.563-100 ng/mL.

• 

  Affinity and Kinetic Characterization of 66678-1-Ig

  Biolayer interferometry (BLl) kinetic assay of 66678-1-Ig against Human PSMA/GCPII was performed. The affinity constant is below 1 pM.

PSMA/GCPII Monoclonal Antibody for WB, IHC, IF-P, Cytometric bead array, Indirect ELISA

Cat No. 66678-1-PBS

Clone No.3G4E12

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, Cytometric bead array, Indirect ELISA

Synonyms

FOLH1, PSMA, 3G4E12, Cell growth-inhibiting gene 27 protein, EC:3.4.17.21

---

Product Information

66678-1-PBS targets PSMA/GCPII as part of a matched antibody pair:

MP51112-1: 66678-2-PBS capture and 66678-1-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16594

  Product name: Recombinant human FOLH1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 45-385 aa of BC025672

  Sequence: SSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGG

• Full Name: folate hydrolase (prostate-specific membrane antigen) 1
• Calculated Molecular Weight: 719 aa, 81 kDa
• Observed Molecular Weight: 100-120 kDa
• GenBank Accession Number: BC025672
• Gene Symbol: PSMA
• Gene ID (NCBI): 2346
• RRID: AB_2882032
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q04609
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PSMA(Prostate-specific membrane antigen) is also named as FOLH1, FOLH, NAALAD1, PSM and belongs to the peptidase M28 family. PSMA is a 100-120 kDa integral transmembrane glycoprotein, considered to be a highly specific marker of the prostate gland, and has successfully been used as a marker of circulating prostatic epithelial cells(PMID:10074909; 15680901). It is involved in conversion of the major neurotransmitter (NAAG) to NAA and free glutamate. It has 8 isoforms produced by alternative splicing.