FcZero-rAb® APC Anti-Human PSMA/GCPII Rabbit Recombinant Antibody

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• FcZero-rAb® APC Anti-Human PSMA/GCPII Rabbit Recombinant Antibody (APC-FcA98279)

• Zero Fc receptor binding
• Site-specific conjugation
• One universal isotype

PSMA/GCPII FcZero-rAb^® Recombinant Antibody for FC

Cat No. APC-FcA98279

Clone No.242026E6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

Synonyms

FOLH1, PSMA, Cell growth-inhibiting gene 27 protein, EC:3.4.17.21, FGCP

• 

  FC experiment of LNCaP using APC-FcA98279

  1x10^6 LNCaP cells (left) or HeLa (right) were surface stained with 0.1 ug APC Anti-Human PSMA/GCPII Rabbit RecAb (APC-FcA98279, Clone: 242026E6) (red) or 0.1 ug APC Rabbit IgG Isotype Control RecAb (APC-FcA98136, Clone: 240953C9) (blue). Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive FC detected in: LNCaP cells

Recommended dilution

• Flow Cytometry (FC): FC : 5 ul per 10^6 cells in a 100 µl suspension

This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 ul per 10^6 cells in a 100 µl suspension or 5 ul per 100 µl of whole blood.

Sample-dependent, Check data in validation data gallery.

Product Information

APC-FcA98279 targets PSMA/GCPII in FC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0216

  Product name: Recombinant Human PSMA/GCPII protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec

  Tag: N-6*His

  Domain: 44-750 aa of NM_004476.3

  Sequence: KSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA

• Full Name: folate hydrolase (prostate-specific membrane antigen) 1
• Calculated Molecular Weight: 84 kDa
• GenBank Accession Number: NM_004476.3
• Gene Symbol: PSMA
• Gene ID (NCBI): 2346
• RRID: AB_3746617
• Conjugate: APC Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 650 nm / 660 nm
• Excitation Laser: Red Laser (633 nm)
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q04609
• Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

PSMA (Prostate-specific membrane antigen) is also named as FOLH1, FOLH, NAALAD1, PSM and belongs to the peptidase M28 family. PSMA is a 100-120 kDa integral transmembrane glycoprotein, considered to be a highly specific marker of the prostate gland, and has successfully been used as a marker of circulating prostatic epithelial cells(PMID:10074909; 15680901). It is involved in conversion of the major neurotransmitter (NAAG) to NAA and free glutamate. It has 8 isoforms produced by alternative splicing.