PSMB10 Polyclonal antibody

• 

  WB analysis using 15976-1-AP

  Raji cells were subjected to SDS PAGE followed by western blot with 15976-1-AP (PSMB10 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human liver using 15976-1-AP

  human liver tissue were subjected to SDS PAGE followed by western blot with 15976-1-AP (PSMB10 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver cancer using 15976-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 15976-1-AP (PSMB10 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 15976-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 15976-1-AP (PSMB10 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

PSMB10 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 15976-1-AP

Publications(7)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

beta2i, LMP10, Low molecular mass protein 10, Macropain subunit MECl 1, MECL1, Proteasome MECl 1, Proteasome subunit beta 2i, PSMB10

---

Tested Applications

• Positive WB detected in: Raji cells, human liver tissue
• Positive IHC detected in: human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 5 publications below
• IHC: See 1 publications below

Product Information

15976-1-AP targets PSMB10 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8764

  Product name: Recombinant human PSMB10 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-273 aa of BC017198

  Sequence: MLKPALEPRGGFSFENCQRNASLERVLPGLKVPHARKTGTTIAGLVFQDGVILGADTRATNDSVVADKSCEKIHFIAPKIYCCGAGVAADAEMTTRMVASKMELHALSTGREPRVATVTRILRQTLFRYQGHVGASLIVGGVDLTGPQLYGVHPHGSYSRLPFTALGSGQDAALAVLEDRFQPNMTLEAAQGLLVEAVTAGILGDLGSGGNVDACVITKTGAKLLRTLSSPTEPVKRSGRYHFVPGTTAVLTQTVKPLTLELVEETVQAMEVE

• Full Name: proteasome (prosome, macropain) subunit, beta type, 10
• Calculated Molecular Weight: 273 aa, 29 kDa
• Observed Molecular Weight: 29 kDa
• GenBank Accession Number: BC017198
• Gene Symbol: PSMB10
• Gene ID (NCBI): 5699
• RRID: AB_2171872
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P40306
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The proteasome subunit, beta type 10 (PSMB10) gene regulated by interferon-gamma is a core part of the 26S proteasome complex, which is an important protein degrading system. Study identifies immunosubunit PSMB10 as a novel regulator that contributes to Ang II-induced atrial fibrillation (AF) and suggests that inhibition of PSMB10 may represent a potential therapeutic target for treating hypertensive AF. (PMID: 29507100, PMID: 16965406)

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Cell Rep; ECM29/proteasome-mediated self-antigen generation by CNS-resident neuroglia promotes regulatory T cell activation; Authors - Sheng-Wen Chen
	WB	Front Pharmacol; Selective Inhibition of the Immunoproteasome β5i Prevents PTEN Degradation and Attenuates Cardiac Hypertrophy.; Authors - Xin Xie
	WB	Metab Brain Dis; Molecular alteration of the proteasome contributes to AD-like pathology in the brain of HFD-STZ diabetic rats; Authors - Han Gao
	WB	Biochem Pharmacol; Melatonin inhibits angiotensin II-induced atrial fibrillation through preventing degradation of Ang II Type I Receptor-Associated Protein (ATRAP); Authors - Xin Xie
human	WB	Int J Mol Sci; Gemcitabine Modulates HLA-I Regulation to Improve Tumor Antigen Presentation by Pancreatic Cancer Cells; Authors - Alaina C Larson
	WB	Sci Rep; CGRPβ suppresses the pathogenesis of ulcerative colitis via the immunoproteasome; Authors - Tatsuya Shibao