PSMB8 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• PSMB8 Recombinant monoclonal antibody, PBS Only (86241-1-PBS)

• 

  WB analysis using 86241-1-RR (same clone as 86241-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86241-1-RR (PSMB8 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86241-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 86241-1-RR (same clone as 86241-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using PSMB8 antibody (86241-1-RR, Clone: 250865C7 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 86241-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 86241-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86241-1-RR against Human PSMB8 were performed. The affinity constant is below 1 pM.

PSMB8 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 86241-1-PBS

Clone No.250865C7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

EC:3.4.25.1, LMP7, Proteasome subunit beta type 8, Proteasome subunit beta type-8, Proteasome subunit beta-5i

---

Product Information

86241-1-PBS targets PSMB8 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag6660

  Product name: Recombinant human PSMB8 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-272 aa of BC001114

  Sequence: MLIGTPTPRDTTPSSWLTSSLLVEAAPLDDTTLPTPVSSGCPGLEPTEFFQSLGGDGERNVQIEMAHGTTTLAFKFQHGVIAAVDSRASAGSYISALRVNKVIEINPYLLGTMSGCAADCQYWERLLAKECRLYYLRNGERISVSAASKLLSNMMCQYRGMGLSMGSMICGWDKKGPGLYYVDEHGTRLSGNMFSTGSGNTYAYGVMDSGYRPNLSPEEAYDLGRRAIAYATHRDSYSGGVVNMYHMKEDGWVKVESTDVSDLLHQYREANQ

• Full Name: proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional peptidase 7)
• Calculated Molecular Weight: 30 kDa
• Observed Molecular Weight: 23 kDa, 30 kDa
• GenBank Accession Number: BC001114
• Gene Symbol: PSMB8
• Gene ID (NCBI): 5696
• RRID: AB_3744743
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P28062
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.