Use Able AI chat for product recommendations

PSMB9 Monoclonal antibody

PSMB9 Monoclonal Antibody for WB, IHC, ELISA

Cat No. 67748-1-Ig
Clone No. 1C7C8
Publications (1)
Review Product
Download datasheet

Host / Isotype

Mouse / IgG2a

Reactivity

human, rat

Applications

WB, IHC, ELISA

LMP2, 1C7C8, EC:3.4.25.1, Proteasome subunit beta type-9, Proteasome subunit beta-1i

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for PSMB9 in ?

Tested Applications

Positive WB detected inRaji cells, rat spleen tissue, Ramos cells, Daudi cells, HL-60 cells, THP-1 cells
Positive IHC detected inhuman colon cancer tissue, human spleen tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:300-1:1200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67748-1-Ig targets PSMB9 in WB, IHC, ELISA applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Cited Reactivityhuman
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag6802

Product name: Recombinant human PSMB9 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-219 aa of BC065513

Sequence: MLRAGAPTGDLPRAGEVHTGTTIMAVEFDGGVVMGSDSRVSAGEAVVNRVFDKLSPLHERIYCALSGSAADAQAVADMAAYQLELHGIELEEPPLVLAAANVVRNISYKYREDLSAHLMVAGWDQREGGQVYGTLGGMLTRQPFAIGGSGSTFIYGYVDAAYKPGMSPEECRRFTTDAIALAMSRDGSSGGVIYLVTITAAGVDHRVILGNELPKFYDE

Predict reactive species
Full Name proteasome (prosome, macropain) subunit, beta type, 9 (large multifunctional peptidase 2)
Calculated Molecular Weight 23 kDa
Observed Molecular Weight20-23 kDa
GenBank Accession NumberBC065513
Gene Symbol PSMB9
Gene ID (NCBI) 5698
RRIDAB_2918517
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP28065
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PSMB9, also named as LMP2, PSMB6i and RING12, belongs to the peptidase T1B family. The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. Replacement of PSMB6 by PSMB9 increases the capacity of the immunoproteasome to cleave model peptides after hydrophobic and basic residues. High expression of PSMB9 associated with the poor prognosis of patients with NPC.

Protocols

Product Specific Protocols
IHC protocol for PSMB9 antibody 67748-1-IgDownload protocol
WB protocol for PSMB9 antibody 67748-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The PSMB9 Monoclonal antibody (1C7C8), catalog number 67748-1-Ig, has a total of 1 citation. The citation appears in Frontiers in Immunology (2025), in a study identifying novel ubiquitination-related biomarkers for Crohn's disease through multi-omics analysis and experimental validation. The antibody was used for Western blot and immunohistochemistry on human samples, placing its research context within inflammatory bowel disease and ubiquitin-proteasome pathway biology.

SpeciesApplicationTitle
humanWB,IHC

Front Immunol

Novel ubiquitination-related biomarkers for Crohn's disease identified by multi-omics study and experimental validation.

Authors - Jia Hu
Loading...
||
New chat

Able™

正在加载,请稍候...