PSMB9 Monoclonal antibody

• 

  WB analysis using 67748-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67748-1-Ig (PSMB9 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control.

• 

  WB analysis of rat spleen using 67748-1-Ig

  rat spleen tissue were subjected to SDS PAGE followed by western blot with 67748-1-Ig (PSMB9 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon cancer using 67748-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67748-1-Ig (PSMB9 antibody) at dilution of 1:600 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 67748-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67748-1-Ig (PSMB9 antibody) at dilution of 1:600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human spleen using 67748-1-Ig

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 67748-1-Ig (PSMB9 antibody) at dilution of 1:600 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

PSMB9 Monoclonal Antibody for WB, IHC, ELISA

Cat No. 67748-1-Ig

Clone No.1C7C8

Host / Isotype

Mouse / IgG2a

Reactivity

Human, rat

Applications

WB, IHC, ELISA

Synonyms

beta1i, LMP2, Low molecular mass protein 2, Macropain chain 7, Proteasome chain 7, Proteasome subunit beta 1i, Proteasome subunit beta type 9, PSMB6i, PSMB9, RING12

---

Tested Applications

• Positive WB detected in: Raji cells, rat spleen tissue, Ramos cells, Daudi cells, HL-60 cells, THP-1 cells
• Positive IHC detected in: human colon cancer tissue, human spleen tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:300-1:1200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67748-1-Ig targets PSMB9 in WB, IHC, ELISA applications and shows reactivity with Human, rat samples.

• Tested Reactivity: Human, rat
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6802

  Product name: Recombinant human PSMB9 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-219 aa of BC065513

  Sequence: MLRAGAPTGDLPRAGEVHTGTTIMAVEFDGGVVMGSDSRVSAGEAVVNRVFDKLSPLHERIYCALSGSAADAQAVADMAAYQLELHGIELEEPPLVLAAANVVRNISYKYREDLSAHLMVAGWDQREGGQVYGTLGGMLTRQPFAIGGSGSTFIYGYVDAAYKPGMSPEECRRFTTDAIALAMSRDGSSGGVIYLVTITAAGVDHRVILGNELPKFYDE

• Full Name: proteasome (prosome, macropain) subunit, beta type, 9 (large multifunctional peptidase 2)
• Calculated Molecular Weight: 23 kDa
• Observed Molecular Weight: 20-23 kDa
• GenBank Accession Number: BC065513
• Gene Symbol: PSMB9
• Gene ID (NCBI): 5698
• RRID: AB_2918517
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P28065
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.