PSMB9 Monoclonal antibody, PBS Only

• 

  WB analysis using 67748-1-Ig (same clone as 67748-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67748-1-Ig (PSMB9 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 67748-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat spleen using 67748-1-Ig (same clone as 67748-1-PBS)

  rat spleen tissue were subjected to SDS PAGE followed by western blot with 67748-1-Ig (PSMB9 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67748-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 67748-1-Ig (same clone as 67748-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67748-1-Ig (PSMB9 antibody) at dilution of 1:600 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67748-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 67748-1-Ig (same clone as 67748-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67748-1-Ig (PSMB9 antibody) at dilution of 1:600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67748-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human spleen using 67748-1-Ig (same clone as 67748-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 67748-1-Ig (PSMB9 antibody) at dilution of 1:600 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67748-1-PBS in a different storage buffer formulation.

PSMB9 Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 67748-1-PBS

Clone No.1C7C8

Host / Isotype

Mouse / IgG2a

Reactivity

human, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

LMP2, 1C7C8, EC:3.4.25.1, Proteasome subunit beta type-9, Proteasome subunit beta-1i

---

Product Information

67748-1-PBS targets PSMB9 in WB, IHC, Indirect ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6802

  Product name: Recombinant human PSMB9 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-219 aa of BC065513

  Sequence: MLRAGAPTGDLPRAGEVHTGTTIMAVEFDGGVVMGSDSRVSAGEAVVNRVFDKLSPLHERIYCALSGSAADAQAVADMAAYQLELHGIELEEPPLVLAAANVVRNISYKYREDLSAHLMVAGWDQREGGQVYGTLGGMLTRQPFAIGGSGSTFIYGYVDAAYKPGMSPEECRRFTTDAIALAMSRDGSSGGVIYLVTITAAGVDHRVILGNELPKFYDE

• Full Name: proteasome (prosome, macropain) subunit, beta type, 9 (large multifunctional peptidase 2)
• Calculated Molecular Weight: 23 kDa
• Observed Molecular Weight: 20-23 kDa
• GenBank Accession Number: BC065513
• Gene Symbol: PSMB9
• Gene ID (NCBI): 5698
• RRID: AB_2918517
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P28065
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PSMB9, also named as LMP2, PSMB6i and RING12, belongs to the peptidase T1B family. The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. Replacement of PSMB6 by PSMB9 increases the capacity of the immunoproteasome to cleave model peptides after hydrophobic and basic residues. High expression of PSMB9 associated with the poor prognosis of patients with NPC.