PSMC1 Polyclonal antibody

• 

  WB analysis using 11196-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11196-1-AP (PSMC1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 11196-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 11196-1-AP (PSMC1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse lung using 11196-1-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 11196-1-AP (PSMC1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A549 using 11196-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 11196-1-AP (PSMC1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 11196-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 11196-1-AP (PSMC1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse cerebellum using 11196-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 11196-1-AP (PSMC1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat cerebellum using 11196-1-AP

  Immunohistochemical analysis of paraffin-embedded rat cerebellum tissue slide using 11196-1-AP (PSMC1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

PSMC1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 11196-1-AP

Publications(8)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

26S proteasome AAA-ATPase subunit RPT2, 26S proteasome regulatory subunit 4, P26S4

---

Tested Applications

• Positive WB detected in: DU 145 cells, A549 cells, HeLa cells, Jurkat cells, mouse lung tissue, mouse brain tissue, rat brain tissue
• Positive IHC detected in: mouse cerebellum tissue, rat cerebellum tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 6 publications below

Product Information

11196-1-AP targets PSMC1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1677

  Product name: Recombinant human PSMC1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 77-440 aa of BC016368

  Sequence: EFIRNQEQMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIIDDNRAIVSTSVGSEHYVSILSFVDKDLLEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDNQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDDLIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPEGLYL

• Full Name: proteasome (prosome, macropain) 26S subunit, ATPase, 1
• Calculated Molecular Weight: 49 kDa
• Observed Molecular Weight: 52-57 kDa
• GenBank Accession Number: BC016368
• Gene Symbol: PSMC1
• Gene ID (NCBI): 5700
• RRID: AB_2284521
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P62191
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PSMC1(26S protease regulatory subunit 4) is also named as p26s4 and belongs to the AAA ATPase family.The 26S protease is involved in the ATP-dependent degradation of ubiquitinated proteins. The regulatory (or ATPase) complex confers ATP dependency and substrate specificity to the 26S complex.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse,human	WB	Sci Adv; Lipid-anchored proteasomes control membrane protein homeostasis; Authors - Ruizhu Zhang
human		Pharmacol Res; Curcumin modulates β-catenin stabilization via targeting proteasomal deubiquitinating enzyme USP14; Authors - Mengzhen Shen
human	WB	Oncogene; The degradation of p53 and its major E3 ligase Mdm2 is differentially dependent on the proteasomal ubiquitin receptor S5a.; Authors - Sparks A A
		Cell Mol Life Sci; The insulin-degrading enzyme is an allosteric modulator of the 20S proteasome and a potential competitor of the 19S.; Authors - Diego Sbardella
human	WB	PLoS One; Inactive USP14 and inactive UCHL5 cause accumulation of distinct ubiquitinated proteins in mammalian cells.; Authors - Jayashree Chadchankar
rat	WB	Neuropathology; Adenoviral expression of TDP-43 and FUS genes and shRNAs for protein degradation pathways in rodent motoneurons in vitro and in vivo.; Authors - Watabe Kazuhiko K