CoraLite® Plus 488-conjugated PSMD5 Monoclonal antibody

• 

  IF Staining of A431 using CL488-67682

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using CoraLite® Plus 488 PSMD5 antibody (CL488-67682, Clone: 1D5F7 ) at dilution of 1:200.

PSMD5 Monoclonal Antibody for IF/ICC

Cat No. CL488-67682

Clone No.1D5F7

Host / Isotype

Mouse / IgG3

Reactivity

Human, pig, rat, rabbit, mouse

Applications

IF/ICC

Synonyms

26S protease subunit S5 basic, 26S proteasome subunit S5B, KIAA0072, PSMD5, S5B

---

Tested Applications

• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67682 targets PSMD5 in IF/ICC applications and shows reactivity with Human, pig, rat, rabbit, mouse samples.

• Tested Reactivity: Human, pig, rat, rabbit, mouse
• Host / Isotype: Mouse / IgG3
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19298

  Product name: Recombinant human PSMD5 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 154-504 aa of BC014478

  Sequence: LTQAGLEALFESNLLDDLKSVMKTNDIVRYRVYELIIEISSVSPESLNYCTTSGLVTQLLRELTGEDVLVRATCIEMVTSLAYTHHGRQYLAQEGVIDQISNIIVGADSDPFSSFYLPGFVKFFGNLAVMDSPQQICERYPIFVEKVFEMIESQDPTMIGVAVDTVGILGSNVEGKQVLQKTGTRFERLLMRIGHQSKNAPVELKIRCLDAISSLLYLPPEQQTDDLLRMTESWFSSLSRDPLELFRGISSQPFPELHCAALKVFTAIANQPWAQKLMFNSPGFVEYVVDRSVEHDKASKDAKYELVKALANSKTIAEIFGNPNYLRLRTYLSEGPYYVKPVSTTAVEGAE

• Full Name: proteasome (prosome, macropain) 26S subunit, non-ATPase, 5
• Calculated Molecular Weight: 504 aa, 56 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC014478
• Gene Symbol: PSMD5
• Gene ID (NCBI): 5711
• RRID: AB_2934561
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q16401
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.