Tested Applications
| Positive WB detected in | COLO 320 cells, mouse spleen tissue, HepG2 cells, Caco-2 cells, HCT 116 cells |
| Positive IP detected in | COLO 320 cells |
| Positive IHC detected in | human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:10-1:100 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
14907-1-AP targets PSME3 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag6702 Product name: Recombinant human PSME3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-254 aa of BC001423 Sequence: MASLLKVDQEVKLKVDSFRERITSEAEDLVANFFPKKLLELDSFLKEPILNIHDLTQIHSDMNLPVPDPILLTNSHDGLDGPTYKKRRLDECEEAFQGTKVFVMPNGMLKSNQQLVDIIEKVKPEIRLLIEKCNTVKMWVQLLIPRIEDGNNFGVSIQEETVAELRTVESEAASYLDQISRYYITRAKLVSKIAKYPHVEDYRRTVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRSSNAETLY Predict reactive species |
| Full Name | proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki) |
| Calculated Molecular Weight | 30 kDa |
| Observed Molecular Weight | 30 kDa |
| GenBank Accession Number | BC001423 |
| Gene Symbol | PSME3 |
| Gene ID (NCBI) | 10197 |
| RRID | AB_2171098 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P61289 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PSME3 gene encodes proteasome activator complex subunit 3, which is also called REG-gamma or PA28-gamma. REG-gamma activates the trypsin-like catalytic subunit of the proteasome thus is a proteasome regulator. MDM2-TP53 interaction which promotes ubiquitination- and MDM2-dependent proteasomal degradation of TP53, may be promoted by REG-gamma resulting in inhibited apoptosis after DNA damage. REG-gamma may also be involved in cell cycle regulation.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for PSME3 antibody 14907-1-AP | Download protocol |
| IHC protocol for PSME3 antibody 14907-1-AP | Download protocol |
| IP protocol for PSME3 antibody 14907-1-AP | Download protocol |
| WB protocol for PSME3 antibody 14907-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The PSME3 Polyclonal antibody (Cat# 14907-1-AP) has 13 citations spanning journals including Nature Aging, EMBO Journal, Cancer Letters, Cell Death & Disease, EBioMedicine, Journal of Biomedical Science, Inflammation, American Journal of Pathology, Retrovirology, Translational Lung Cancer Research, PeerJ, American Journal of Translational Research, and bioRxiv. Research fields cover proteasome biology, cancer (pancreatic, lung, osteosarcoma, myeloma, chordoma), aging, inflammation, fibrosis, senescence, and retrovirology.
| Species | Application | Title |
|---|---|---|
Nat Aging Cold temperature extends longevity and prevents disease-related protein aggregation through PA28γ-induced proteasomes | ||
J Biomed Sci PPM1D is directly degraded by proteasomes in a ubiquitination-independent manner through its carboxyl-terminal region. | ||
Cell Death Dis Ubiquitin-independent pathway regulates the RIT1-MAPK pathway in chordoma progression.
| ||
Cancer Lett Proteasome activator subunit 3 promotes pancreatic cancer growth via c-Myc-glycolysis signaling axis. | ||
EBioMedicine Indirubin-3'-monoxime acts as proteasome inhibitor: Therapeutic application in multiple myeloma.
| ||
EMBO J PQBP3 prevents senescence by suppressing PSME3-mediated proteasomal Lamin B1 degradation |
Reviews
What customers say
The single review for this antibody is highly positive (5 stars). The reviewer used it for Western Blot and Immunofluorescence on epithelial chicken cells at a 1:1000 dilution. They noted that finding antibodies specific to avian proteins is very difficult and that they had tried several antibodies from different companies. They concluded this antibody was by far the best they had tested, and also cost-effective. Overall, the feedback highlights strong specificity for avian targets and good value.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Laetitia (Verified Customer) (03-21-2024) | Finding antibodies specific to avian proteins is very difficult. I have tried different antibodies from different companies so far. This antibody is by far the best (cost efficient as well)
|
