PSME3 Monoclonal antibody

PSME3 Monoclonal Antibody for WB, IHC, ELISA
Cat No. 67629-1-Ig
Clone No.2A8E8

Host / Isotype

Mouse / IgG1

Reactivity

Human, Rat

Applications

WB, IHC, ELISA

Ki, Ki nuclear autoantigen, PA28 gamma, PA28G, PA28gamma, PSME3, REG GAMMA

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inLNCaP cells, HeLa cells, HepG2 cells, K-562 cells, HSC-T6 cells
Positive IHC detected inhuman liver cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunohistochemistry (IHC)IHC : 1:250-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67629-1-Ig targets PSME3 in WB, IHC, ELISA applications and shows reactivity with Human, Rat samples.

Tested Reactivity Human, Rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag6716

Product name: Recombinant human PSME3 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-254 aa of BC001423

Sequence: MASLLKVDQEVKLKVDSFRERITSEAEDLVANFFPKKLLELDSFLKEPILNIHDLTQIHSDMNLPVPDPILLTNSHDGLDGPTYKKRRLDECEEAFQGTKVFVMPNGMLKSNQQLVDIIEKVKPEIRLLIEKCNTVKMWVQLLIPRIEDGNNFGVSIQEETVAELRTVESEAASYLDQISRYYITRAKLVSKIAKYPHVEDYRRTVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRSSNAETLY

Predict reactive species
Full Name proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki)
Calculated Molecular Weight 30 kDa
Observed Molecular Weight 32 kDa
GenBank Accession NumberBC001423
Gene Symbol PSME3
Gene ID (NCBI) 10197
RRIDAB_2882830
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP61289
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PSME3 gene encodes proteasome activator complex subunit 3, which is also called REG-gamma or PA28-gamma. REG-gamma activates the trypsin-like catalytic subunit of the proteasome thus is a proteasome regulator. MDM2-TP53 interaction which promotes ubiquitination- and MDM2-dependent proteasomal degradation of TP53, may be promoted by REG-gamma resulting in inhibited apoptosis after DNA damage. REG-gamma may also be involved in cell cycle regulation.

Protocols

Product Specific Protocols
IHC protocol for PSME3 antibody 67629-1-IgDownload protocol
WB protocol for PSME3 antibody 67629-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...