PSMG1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PSMG1 Polyclonal antibody, PBS Only (10335-1-PBS)

• 

  WB analysis using 10335-1-AP (same clone as 10335-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 10335-1-AP (PSMG1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10335-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 10335-1-AP (same clone as 10335-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 10335-1-AP (PSMG1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10335-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 10335-1-AP (same clone as 10335-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 10335-1-AP (PSMG1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10335-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 10335-1-AP (same clone as 10335-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 10335-1-AP (PSMG1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10335-1-PBS in a different storage buffer formulation.

PSMG1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 10335-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

10335-1-PBS targets PSMG1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0303

  Product name: Recombinant human PSMG1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 92-249 aa of BC003619

  Sequence: VWEEVGCAKLWNEWCRTTDTTHLSSTEAFCVFYHLKSNPSVFLCQCSCYVAEDQQYQWLEKVFGSCPRKNMQITILTCRHVTDYKTSESTGSLPSPFLRALKTQNFKDSACCPLLEQPNIVHDLPAAVLSYCQVWKIPAILYLCYTDVMKLDLITVEA

• Full Name: proteasome (prosome, macropain) assembly chaperone 1
• Calculated Molecular Weight: 288 aa, 33 kDa
• Observed Molecular Weight: 30-33 kDa
• GenBank Accession Number: BC003619
• Gene Symbol: PSMG1
• Gene ID (NCBI): 8624
• RRID: AB_2877733
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95456
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.