PTCHD4 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PTCHD4 Polyclonal antibody, PBS Only (33489-1-PBS)

• 

  WB analysis using 33489-1-AP (same clone as 33489-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 33489-1-AP (PTCHD4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 33489-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 33489-1-AP (same clone as 33489-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 33489-1-AP (PTCHD4 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 33489-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 33489-1-AP (same clone as 33489-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 33489-1-AP (PTCHD4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 33489-1-PBS in a different storage buffer formulation.

PTCHD4 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 33489-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

C6orf138, p53-regulated patched protein, Patched domain-containing protein 4, PTCH53

---

Product Information

33489-1-PBS targets PTCHD4 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37091

  Product name: Recombinant human C6orf138 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 150-323 aa of BC137359

  Sequence: SDGANIINLLASDSPSVSYAMVQQKYFSNYSPVIGFYVYEPLEYWNSSVQDDLRRLCSGFTAVSWVEQYYQFLKVSNVSANNKSDFISVLQSSFLKKPEFQHFRNDIIFSKAGDESNIIASRLYLVARTSRDKQKEITEVLEKLRPLSLSKSIRFIVFNPSFVFMDHYSLSVTV

• Full Name: chromosome 6 open reading frame 138
• Observed Molecular Weight: 90 kDa
• GenBank Accession Number: BC137359
• Gene Symbol: C6orf138
• Gene ID (NCBI): 442213
• RRID: AB_3742990
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q6ZW05
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PTCHD4 (Patched Domain-Containing Protein 4; formerly C6orf138) is a 96 kDa multi-pass transmembrane protein encoded at 6p12.3 that belongs to the Patched family of cholesterol/lipid transporters .