PTDSS1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PTDSS1 Polyclonal antibody, PBS Only (20820-1-PBS)

• 

  WB analysis using 20820-1-AP (same clone as 20820-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 20820-1-AP (PTDSS1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20820-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 20820-1-AP (same clone as 20820-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 20820-1-AP (PTDSS1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20820-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 20820-1-AP (same clone as 20820-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using PTDSS1 antibody (20820-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 20820-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 20820-1-AP (same clone as 20820-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using PTDSS1 antibody (20820-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 20820-1-PBS in a different storage buffer formulation.

PTDSS1 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 20820-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

PSS1, EC:2.7.8.29, KIAA0024, Phosphatidylserine synthase 1, PSS-1

---

Product Information

20820-1-PBS targets PTDSS1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14170

  Product name: Recombinant human PTDSS1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 394-473 aa of BC002376

  Sequence: TTFLCLYGMIWYAEHYGHREKTYSECEDGTYSPEISWHHRKGTKGSEDSPPKHAGNNESHSSRRRNRHSKSKVTNGVGKK

• Full Name: phosphatidylserine synthase 1
• Calculated Molecular Weight: 473 aa, 56 kDa
• Observed Molecular Weight: 38~40 kDa
• GenBank Accession Number: BC002376
• Gene Symbol: PTDSS1
• Gene ID (NCBI): 9791
• RRID: AB_3669350
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P48651
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PTDSS1 gene encodes the enzyme phosphatidylserine synthase 1 (PSS1), which catalyzes the production of phosphatidylserine (PS), a membrane phospholipid involved in different cellular processes such as development, cell signaling, apoptosis, and blood coagulation (PMID: 35224839). PTDSS1 is highly enriched in mitochondria-associated membranes (MAM) and is largely excluded from the bulk of the endoplasmic reticulum (ER). Low apparent molecular mass of 40 kDa compared with the size predicted was attributed to the exceptionally high content of hydrophobic amino acids in PSS1 (PMID: 10938271).