PTEN Monoclonal antibody

• Home
• Products
• Primary Antibodies
• PTEN Monoclonal antibody (60300-3-Ig)

PTEN Monoclonal Antibody for WB, ELISA

Cat No. 60300-3-Ig

Clone No.4D8G9

Publications(23)

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

WB, IF, ELISA

Synonyms

10q23del, 4D8G9, Bannayan Zonana syndrome, BC005821, BZS

• 

  WB analysis using 60300-3-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 60300-3-Ig (PTEN antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 60300-3-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 60300-3-Ig (PTEN antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: HeLa cells, NIH/3T3 cells, MCF-7 cells, DU 145 cells, HT-29 cells, C6 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:5000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

60300-3-Ig targets PTEN in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17274

  Product name: Recombinant human PTEN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 204-403 aa of BC005821

  Sequence: PMFSGGTCNPQFVVCQLKVKIYSSNSGPTRREDKFMYFEFPQPLPVCGDIKVEFFHKQNKMLKKDKMFHFWVNTFFIPGPEETSEKVENGSLCDQEIDSICSIERADNDKEYLVLTLTKNDLDKANKDKANRYFSPNFKVKLYFTKTVEEPSNPEASSSTSVTPDVSDNEPDHYRYSDTTDSDPENEPFDEDQHTQITK

• Full Name: phosphatase and tensin homolog
• Calculated Molecular Weight: 47 kDa
• Observed Molecular Weight: 55 kDa
• GenBank Accession Number: BC005821
• Gene Symbol: PTEN
• Gene ID (NCBI): 5728
• RRID: AB_3743213
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P60484
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PTEN (also designated MMAC1), products of tumor suppressor genes, are found deleted in most human gliomas. The PTEN genes are also mutated in many other tumors, such as brain, breast, kidney and prostate cancers. PTEN is a protein tyrosine phosphatase that may terminate the signaling transduction pathways mediated by PI 3-kinase/Akt. PTEN has an apparent molecular weight of 55 kDa.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Nat Commun; Macrophage ALDH2 drives immunotherapy resistance by silencing CXCL9 through metabolic-epigenetic crosstalk; Authors - Huiying Fang
mouse	WB	ACS Nano; Remodeling of Effector and Regulatory T Cells by Capture and Utilization of miRNAs Using Nanocomposite Hydrogel for Tumor-Specific Photothermal Immunotherapy; Authors - Li Chen
human	WB	Cell Commun Signal; BPC157 drives angiogenesis through FBXO22-dependent stabilization of BACH1.; Authors - Jieyu Zhang
		Phytomedicine; Columbianadin improves M1 polarization of microglia after spinal cord injury by stabilizing PTEN and inhibiting the PI3K/AKT pathway.; Authors - Shining Xiao
mouse	WB	J Pharm Anal; Multi-omics uncovers the critical role of ceramide-mediated Acinetobacter growth suppression in pressure injury healing under aging and malnutrition.; Authors - Zhichao Wang
mouse	WB	Mater Today Bio; From targeted delivery to inflammation suppression: engineering plant exosomes for heart failure therapy post-infarction.; Authors - Xi Tan