Use Able AI chat for product recommendations

CoraLite® Plus 488-conjugated PTEN Recombinant monoclonal antibody

PTEN Uni-rAb® Recombinant Antibody for IF/ICC

Cat No. CL488-80718-7
Clone No.240134F7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

10q23del, 240134F7, Bannayan Zonana syndrome, BC005821, BZS

Formulation:  PBS, Proclin300, BSA, Glycerol
PBS, Proclin300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-80718-7 targets PTEN in IF/ICC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag17274

Product name: Recombinant human PTEN protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 204-403 aa of BC005821

Sequence: PMFSGGTCNPQFVVCQLKVKIYSSNSGPTRREDKFMYFEFPQPLPVCGDIKVEFFHKQNKMLKKDKMFHFWVNTFFIPGPEETSEKVENGSLCDQEIDSICSIERADNDKEYLVLTLTKNDLDKANKDKANRYFSPNFKVKLYFTKTVEEPSNPEASSSTSVTPDVSDNEPDHYRYSDTTDSDPENEPFDEDQHTQITK

Predict reactive species
Full Name phosphatase and tensin homolog
Calculated Molecular Weight 47 kDa
GenBank Accession NumberBC005821
Gene Symbol PTEN
Gene ID (NCBI) 5728
RRIDAB_3673037
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP60484
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

PTEN is one of the most critical tumor suppressors, which functions at different subcellular locations, including the plasma membrane and nucleus. The PTEN protein is located at different subcellular regions-PTEN at the plasma membrane suppresses PI3-kinase signaling in cell growth, whereas PTEN in the nucleus maintains genome integrity. At the plasma membrane, PTEN counteracts PI3 kinase signaling by dephosphorylating the potent second messenger PIP3 to PIP2. The loss of PTEN in cancer cells results in over-activation of AKT and mTOR signaling, leading to excessive stimulation of cell growth and inhibition of cell death. In the nucleus, PTEN functions in DNA repair, genome stability, and cell cycle control through associations with Rad51 and p53. PTEN stability is primarily regulated by phosphorylation of C-terminal tail domains (Thr366, Ser370, Ser380, Thr382, Thr383, and Ser385). The phosphorylation leads to a "closed" state of PTEN and maintains PTEN stability. Dephosphorylation of the C-terminal tail opens the PTEN phosphatase domain, thereby increasing PTEN activity. PTEN protein is of the apparent molecular mass expected for PTEN (55 kDa) and PTENα (70 kDa).(PMID: 33083717, PMID: 20622047, PMID: 24768297)

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 PTEN antibody CL488-80718-7Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...