PTGES3 Monoclonal antibody, PBS Only

• 

  WB analysis using 67736-1-Ig (same clone as 67736-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67736-1-Ig (PTGES3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67736-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 67736-1-Ig (same clone as 67736-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 67736-1-Ig (PTGES3 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67736-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 67736-1-Ig (same clone as 67736-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 67736-1-Ig (PTGES3 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67736-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 67736-1-Ig (same clone as 67736-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using PTGES3 antibody (67736-1-Ig, Clone: 3C11D11 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67736-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 67736-1-Ig (same clone as 67736-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using PTGES3 antibody (67736-1-Ig, Clone: 3C11D11 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67736-1-PBS in a different storage buffer formulation.

PTGES3 Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 67736-1-PBS

Clone No.3C11D11

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse, pig, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

cPGES, Hsp90 co chaperone, P23, Prostaglandin E synthase 3, PTGES3, TEBP, Telomerase binding protein p23

---

Product Information

67736-1-PBS targets PTGES3 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with Human, mouse, pig, rat samples.

• Tested Reactivity: Human, mouse, pig, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7870

  Product name: Recombinant human PTGES3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-160 aa of BC003005

  Sequence: MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE

• Full Name: prostaglandin E synthase 3 (cytosolic)
• Calculated Molecular Weight: 19 kDa
• Observed Molecular Weight: 22 kDa
• GenBank Accession Number: BC003005
• Gene Symbol: PTGES3
• Gene ID (NCBI): 10728
• RRID: AB_2918505
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q15185
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

P23, encoded by the gene PTGES3, plays a key role in glucocorticoid signaling and was increased at the mRNA level in the DLPFC in individuals with schizophrenia (PMID: 24345775). In the GR heterocomplex in vitro, p23 is an obligatory co-factor19 and is the limiting component of the complex44, functioning to stabilize the interaction of the complex with GR in the cytoplasm. Paradoxically, p23 also acts in the nucleus to inhibit GR-mediated gene transcription and disassemble GR transcriptional machinery in the nucleus (PMID: 12077419). In vivo, p23 is critical for appropriate glucocorticoid responsiveness (PMID: 17000766).