• Featured Product
  • KD/KO Validated

PTGES3 Monoclonal antibody

PTGES3 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 67736-1-Ig
Clone No.3C11D11

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, ELISA

3C11D11, cPGES, EC:5.3.99.3, Hsp90 co chaperone, Hsp90 co-chaperone

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, HeLa cells, PC-3 cells, HepG2 cells, HSC-T6 cells, NIH/3T3 cells, pig brain tissue
Positive IHC detected inhuman lung cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67736-1-Ig targets PTGES3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Cited Reactivityhuman, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag7870

Product name: Recombinant human PTGES3 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-160 aa of BC003005

Sequence: MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE

Predict reactive species
Full Name prostaglandin E synthase 3 (cytosolic)
Calculated Molecular Weight 19 kDa
Observed Molecular Weight22 kDa
GenBank Accession NumberBC003005
Gene Symbol PTGES3
Gene ID (NCBI) 10728
RRIDAB_2918505
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ15185
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

P23, encoded by the gene PTGES3, plays a key role in glucocorticoid signaling and was increased at the mRNA level in the DLPFC in individuals with schizophrenia (PMID: 24345775). In the GR heterocomplex in vitro, p23 is an obligatory co-factor19 and is the limiting component of the complex44, functioning to stabilize the interaction of the complex with GR in the cytoplasm. Paradoxically, p23 also acts in the nucleus to inhibit GR-mediated gene transcription and disassemble GR transcriptional machinery in the nucleus (PMID: 12077419). In vivo, p23 is critical for appropriate glucocorticoid responsiveness (PMID: 17000766).

Protocols

Product Specific Protocols
IF protocol for PTGES3 antibody 67736-1-IgDownload protocol
IHC protocol for PTGES3 antibody 67736-1-IgDownload protocol
WB protocol for PTGES3 antibody 67736-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Int Immunopharmacol

High expression of PTGES3 is an independent predictive poor prognostic biomarker and correlates with immune infiltrates in lung adenocarcinoma.

Authors - Pengxiang Gao
ratIF

Curr Pharm Des

Integrated Metabolomics and Proteomics to Decipher Simiao Pill Improving Lipid Homeostasis through PTGES3-mediated Arachidonic Acid Metabolism in AIA Model

Authors - Ying Cai
humanWB

J Transl Med

The integration of multidisciplinary approaches revealed PTGES3 as a novel drug target for breast cancer treatment

Authors - Qinan Yin
humanIHC

Biol Direct

PTGES3 proteolysis using the liposomal peptide-PROTAC approach

Authors - Shiwei Liu
humanWB,IHC

Reprod Sci

Progressively Diminished Prostaglandin E2 Signaling in Concordance with Increasing Fibrosis in Ectopic Endometrium

Authors - Yunhua Yi

Cell Mol Life Sci

TRIM21 ameliorates hepatic glucose and lipid metabolic disorders in type 2 diabetes mellitus by ubiquitination of PEPCK1 and FASN

Authors - Kaini Zhang
Loading...
||
New chat Able
正在加载,请稍候...