PTH1R Polyclonal antibody

PTH1R Polyclonal Antibody for WB, IHC, ELISA
Cat No. 24275-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

parathyroid hormone 1 receptor, PFE, PTH/PTHr receptor, PTH/PTHrP type I receptor, PTH1 receptor, PTH1R, PTHR, PTHR1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inU2OS cells, HepG2 cells, mouse liver tissue
Positive IHC detected inmouse kidney tissue, human pancreas cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

24275-1-AP targets PTH1R in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag17577

Product name: Recombinant human PTH1R protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 468-593 aa of BC110388

Sequence: AEIKKSWSRWTLALDFKRKARSGSSSYSYGPMVSHTSVTNVGPRVGLGLPLSPRLLPTATTNGHPQLPGHAKPGTPALETLETTPPAMAAPKDDGFLNGSCSGLDEEASGPERPPALLQEEWETVM

Predict reactive species
Full Name parathyroid hormone 1 receptor
Calculated Molecular Weight 593 aa, 66 kDa
Observed Molecular Weight 70-80 kDa
GenBank Accession NumberBC110388
Gene Symbol PTH1R
Gene ID (NCBI) 5745
RRIDAB_2879465
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ03431
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PTH1R is a receptor for parathyroid hormone and parathyroid hormone-related peptide (PTHrP). PTH1R is a glycoprotein with seven transmembrane domains and it has an extracellular N-terminus region and an intracellular C-terminus region. The activity of PTH1R is mediated by G proteins which activate adenylyl cyclase. It has been reported that PTHrP and PTH1R are associated with the differentiation of bone and cartilage in the developing stages. PTH1R has several isoforms with 66/59 kDa and PTH1R can form a 120 kDa dimer in the non-reducing condition. 24275-1-AP antibody detects 80 kDa protein which is similar to the results reported in publications.(PMID: 19507249, 27160269)

Loading...
||
New chat Able
正在加载,请稍候...