PTH1R Polyclonal antibody

PTH1R Polyclonal Antibody for WB, IHC, ELISA

Cat No. 29115-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Parathyroid hormone/parathyroid hormone-related peptide receptor, PFE, PTHR, PTHR1

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, mouse kidney tissue, HepG2 cells, mouse liver tissue, rat kidney tissue, rat liver tissue
Positive IHC detected inhuman pancreas cancer tissue, human kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

29115-1-AP targets PTH1R in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag30762

Product name: Recombinant human PTH1R protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 27-188 aa of BC110388

Sequence: DADDVMTKEEQIFLLHRAQAQCGKRLKEVLQRPASIMESDKGWTSASTSGKPRKDKASGKLYPESEEDKEAPTGSRYRGRPCLPEWDHILCWPLGAPGEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWELVPGHNRTWANYSECVKFLTNETREREVFDRLG

Predict reactive species
Full Name parathyroid hormone 1 receptor
Calculated Molecular Weight 593 aa, 66 kDa
Observed Molecular Weight70-80 kDa
GenBank Accession NumberBC110388
Gene Symbol PTH1R
Gene ID (NCBI) 5745
RRIDAB_2918237
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ03431
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PTH1R is a receptor for parathyroid hormone and parathyroid hormone-related peptide (PTHrP). PTH1R is a glycoprotein with seven transmembrane domains and it has an extracellular N-terminus region and an intracellular C-terminus region. The activity of PTH1R is mediated by G proteins which activate adenylyl cyclase. It has been reported that PTHrP and PTH1R are associated with the differentiation of bone and cartilage in the developing stages. PTH1R has several isoforms with 66/59 kDa and PTH1R can form a 120 kDa dimer in the non-reducing condition. With glycosylation modification, the molecular weight of PTH1R will be migrated to 90 kDa (PMID: 16783882).

Protocols

Product Specific Protocols
WB protocol for PTH1R antibody 29115-1-APDownload protocol
IHC protocol for PTH1R antibody 29115-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...