PTH1R Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• PTH1R Recombinant monoclonal antibody (87076-3-RR)

• KD/KO Validated

PTH1R Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 87076-3-RR Copied!

Clone No. 252173F3

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

Parathyroid hormone/parathyroid hormone-related peptide receptor, PFE, PTHR, PTHR1

• 

  WB analysis using 87076-3-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87076-3-RR (PTH1R antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 87076-3-RR

  WB result of PTH1R antibody (87076-3-RR; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-PTH1R transfected HEK-293 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse kidney using 87076-3-RR

  Mouse kidney tissue were subjected to SDS PAGE followed by western blot with 87076-3-RR (PTH1R antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for PTH1R in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, HEK-293 cells, mouse kidney tissue, HepG2 cells, MCF-7 cells, U2OS cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87076-3-RR targets PTH1R in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg6501

  Product name: Recombinant Human PTH1R protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 27-188 aa of NM_000316.2

  Sequence: DADDVMTKEEQIFLLHRAQAQCEKRLKEVLQRPASIMESDKGWTSASTSGKPRKDKASGKLYPESEEDKEAPTGSRYRGRPCLPEWDHILCWPLGAPGEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWELVPGHNRTWANYSECVKFLTNETREREVFDRLG

• Full Name: parathyroid hormone 1 receptor
• Calculated Molecular Weight: 66 kDa
• Observed Molecular Weight: 66 kDa and 90 kDa
• GenBank Accession Number: NM_000316.2
• Gene Symbol: PTH1R
• Gene ID (NCBI): 5745
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q03431
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PTH1R is a receptor for parathyroid hormone and parathyroid hormone-related peptide (PTHrP). PTH1R is a glycoprotein with seven transmembrane domains and it has an extracellular N-terminus region and an intracellular C-terminus region. The activity of PTH1R is mediated by G proteins which activate adenylyl cyclase. It has been reported that PTHrP and PTH1R are associated with the differentiation of bone and cartilage in the developing stages. The calculated molecular weight of PTH1R is 66 kDa, and PTH1R can form a 120 kDa dimer in the non-reducing condition. With glycosylation modification, the molecular weight of PTH1R will migrate to 90 kDa (PMID: 16783882).