PTH1R Recombinant monoclonal antibody, PBS Only (Capture)

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• PTH1R Recombinant monoclonal antibody, PBS Only (Capture) (87076-3-PBS)

PTH1R Uni-rAb^® Recombinant Antibody for WB, Sandwich ELISA, Indirect ELISA

Cat No. 87076-3-PBS Copied!

Clone No. 252173F3

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Sandwich ELISA, Indirect ELISA

Synonyms

Parathyroid hormone/parathyroid hormone-related peptide receptor, PFE, PTHR, PTHR1

• 

  WB analysis using 87076-3-RR (same clone as 87076-3-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87076-3-RR (PTH1R antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87076-3-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 87076-3-RR (same clone as 87076-3-PBS)

  WB result of PTH1R antibody (87076-3-RR; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-PTH1R transfected HEK-293 cells. This data was developed using the same antibody clone with 87076-3-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse kidney using 87076-3-RR (same clone as 87076-3-PBS)

  Mouse kidney tissue were subjected to SDS PAGE followed by western blot with 87076-3-RR (PTH1R antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87076-3-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Sandwich ELISA sample test of MP02999-1

  The mean PTH1R concentration was determined to be 63.56 ng/mL in 786-O cell extract based on a 1.20 mg/mL extract load and 57.87 ng/mL in HK-2 cell extract based on a 1.20 mg/mL extract load.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Sandwich ELISA standard curve of MP02999-1

  Sandwich ELISA standard curve of MP02999-1, Human PTH1R Recombinant Matched Antibody Pair - PBS only. 87076-3-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Eg6501. 87076-2-PBS was HRP conjugated as the detection antibody. Range: 0.313-20 ng/mL.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for PTH1R in ?

Chat with Able

---

Product Information

87076-3-PBS targets PTH1R as part of a matched antibody pair:

MP02999-1: 87076-3-PBS capture and 87076-2-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg6501

  Product name: Recombinant Human PTH1R protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 27-188 aa of NM_000316.2

  Sequence: DADDVMTKEEQIFLLHRAQAQCEKRLKEVLQRPASIMESDKGWTSASTSGKPRKDKASGKLYPESEEDKEAPTGSRYRGRPCLPEWDHILCWPLGAPGEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWELVPGHNRTWANYSECVKFLTNETREREVFDRLG

• Full Name: parathyroid hormone 1 receptor
• Calculated Molecular Weight: 66 kDa
• Observed Molecular Weight: 66 kDa and 90 kDa
• GenBank Accession Number: NM_000316.2
• Gene Symbol: PTH1R
• Gene ID (NCBI): 5745
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q03431
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PTH1R is a receptor for parathyroid hormone and parathyroid hormone-related peptide (PTHrP). PTH1R is a glycoprotein with seven transmembrane domains and it has an extracellular N-terminus region and an intracellular C-terminus region. The activity of PTH1R is mediated by G proteins which activate adenylyl cyclase. It has been reported that PTHrP and PTH1R are associated with the differentiation of bone and cartilage in the developing stages. The calculated molecular weight of PTH1R is 66 kDa, and PTH1R can form a 120 kDa dimer in the non-reducing condition. With glycosylation modification, the molecular weight of PTH1R will migrate to 90 kDa (PMID: 16783882).