PTHLH Polyclonal antibody

• 

PTHLH Polyclonal Antibody for ELISA

Cat No. 10817-1-AP

Publications(11)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IHC, IF, ELISA

Synonyms

PTHR, PTH rP, PLP, Parathyroid hormone-related protein, Parathyroid hormone-like protein

---

Published Applications

• WB: See 3 publications below
• IHC: See 6 publications below
• IF: See 2 publications below

Product Information

10817-1-AP targets PTHLH in WB, IHC, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1133

  Product name: Recombinant human PTHLH protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-175 aa of BC005961

  Sequence: MQRRLVQQWSVAVFLLSYAVPSCGRSVEGLSRRLKRAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLSDTSTTSLELDSR

• Full Name: parathyroid hormone-like hormone
• Calculated Molecular Weight: 20 kDa
• Observed Molecular Weight: 20 kDa
• GenBank Accession Number: BC005961
• Gene Symbol: PTHLH
• Gene ID (NCBI): 5744
• RRID: AB_2173515
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P12272
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	Cell Mol Life Sci; Adamts17 is involved in skeletogenesis through modulation of BMP-Smad1/5/8 pathway.; Authors - Takeshi Oichi
mouse	WB	Front Cell Dev Biol; Macrophage-Mediated Bone Formation in Scaffolds Modified With MSC-Derived Extracellular Matrix Is Dependent on the Migration Inhibitory Factor Signaling Pathway.; Authors - Moyuan Deng
mouse	IF	Bone; Gli1-labeled adult mesenchymal stem/progenitor cells and hedgehog signaling contribute to endochondral heterotopic ossification.; Authors - Chen Kan
mouse	IHC	Int J Oncol; Regulatory roles of miRNAs 16, 133a, and 223 on osteoclastic bone destruction caused by breast cancer metastasis.; Authors - Kazumichi Kitayama
human	IHC	Oncol Rep; Significance of cancer stroma for bone destruction in oral squamous cell carcinoma using different cancer stroma subtypes.; Authors - Qiusheng Shan
human	WB	Onco Targets Ther; PTHLH Predicts the Prognosis of Patients with Oral Leukoplakia.; Authors - Zhongjing Lv