PTP4A1 Monoclonal antibody

PTP4A1 Monoclonal Antibody for WB, IHC, ELISA
Cat No. 67584-1-Ig
Clone No.2C9E10

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

PRL1, PTP4A1/PRL1, 2C9E10, EC:3.1.3.48, PRL-1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inLNCaP cells, Jurkat cells, HeLa cells, HepG2 cells, HEK-293 cells, HSC-T6 cells, NIH/3T3 cells
Positive IHC detected inhuman lung cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunohistochemistry (IHC)IHC : 1:250-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67584-1-Ig targets PTP4A1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag14436

Product name: Recombinant human PTP4A1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-173 aa of BC023975

Sequence: MARMNRPAPVEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDWPFDDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALIEGGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFKDSNGHRNNCCIQ

Predict reactive species
Full Name protein tyrosine phosphatase type IVA, member 1
Calculated Molecular Weight 20 kDa
Observed Molecular Weight18-20 kDa
GenBank Accession NumberBC023975
Gene Symbol PTP4A1
Gene ID (NCBI) 7803
RRIDAB_2923632
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ93096
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PTP4A1(protein tyrosine phosphatase type IVA, member 1), also named as PRL1, HH72, PRL-1, PTP(CAAX1), PTPCAAX1, DKFZp779M0721, belongs to the protein-tyrosine phosphatase family, which play an important role in maintaining appropriate tyrosine phosphorylation levels in the cell during development and tissue regeneration (PMID:19341304). PTP4A1 is a PTPase and that it is highly expressed in growing hepatic cells and some tumor cell lines and is located primarily in the cell nucleus, and its overexpression modulates the growth of cells (PMID:8196618). PTP4A1 can exist as dimer, trimer and higher oligomers in vivo (PMID: 15571731, 18224294).

Protocols

Product Specific Protocols
IF protocol for PTP4A1 antibody 67584-1-IgDownload protocol
IHC protocol for PTP4A1 antibody 67584-1-IgDownload protocol
WB protocol for PTP4A1 antibody 67584-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...