PTP4A1 Monoclonal antibody, PBS Only

PTP4A1 Monoclonal Antibody for WB, IHC, Indirect ELISA
Cat No. 67584-1-PBS
Clone No.2C9E10

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

PRL1, PTP4A1/PRL1, 2C9E10, EC:3.1.3.48, PRL-1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67584-1-PBS targets PTP4A1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag14436

Product name: Recombinant human PTP4A1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-173 aa of BC023975

Sequence: MARMNRPAPVEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDWPFDDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALIEGGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFKDSNGHRNNCCIQ

Predict reactive species
Full Name protein tyrosine phosphatase type IVA, member 1
Calculated Molecular Weight 20 kDa
Observed Molecular Weight18-20 kDa
GenBank Accession NumberBC023975
Gene Symbol PTP4A1
Gene ID (NCBI) 7803
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ93096
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

PTP4A1(protein tyrosine phosphatase type IVA, member 1), also named as PRL1, HH72, PRL-1, PTP(CAAX1), PTPCAAX1, DKFZp779M0721, belongs to the protein-tyrosine phosphatase family, which play an important role in maintaining appropriate tyrosine phosphorylation levels in the cell during development and tissue regeneration (PMID:19341304). PTP4A1 is a PTPase and that it is highly expressed in growing hepatic cells and some tumor cell lines and is located primarily in the cell nucleus, and its overexpression modulates the growth of cells (PMID:8196618). PTP4A1 can exist as dimer, trimer and higher oligomers in vivo (PMID: 15571731, 18224294).

Loading...
||
New chat Able
正在加载,请稍候...