PTPIP51 Polyclonal antibody

• 

  WB analysis using 20641-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 20641-1-AP (PTPIP51 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HEK-293 using 20641-1-AP

  IP result of anti-PTPIP51 (IP:20641-1-AP, 4ug; Detection:20641-1-AP 1:1000) with HEK-293 cells lysate 1100ug.

• 

  IHC staining of human skin using 20641-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin using 20641-1-AP (PTPIP51 antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human skin using 20641-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin using 20641-1-AP (PTPIP51 antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human paracancerous of skin cancer using 20641-1-AP

  Immunohistochemical analysis of paraffin-embedded human paracancerous of skin cancer slide using 20641-1-AP (PTPIP51 antibody) at dilution of 1:600 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human cervical cancer using 20641-1-AP

  Immunohistochemical analysis of paraffin-embedded human cervical cancer using 20641-1-AP (PTPIP51 antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human cervical cancer using 20641-1-AP

  Immunohistochemical analysis of paraffin-embedded human cervical cancer using 20641-1-AP (PTPIP51 antibody) at dilution of 1:100 (under 40x lens).

• Featured Product
• KD/KO Validated

PTPIP51 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 20641-1-AP

Publications(23)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (3)

Applications

WB, IHC, IF, IP, COIP, ELISA

Synonyms

FAM82A2, FAM82C, hRMD 3, hRMD-3, hucep-10

---

Tested Applications

• Positive WB detected in: HEK-293 cells, Jurkat cells
• Positive IP detected in: HEK-293 cells
• Positive IHC detected in: human paracancerous of skin cancer, human cervical cancer tissue, human skin tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:100-1:1200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 3 publications below
• WB: See 15 publications below
• IHC: See 2 publications below
• IF: See 9 publications below
• CoIP: See 2 publications below

Product Information

20641-1-AP targets PTPIP51 in WB, IHC, IF, IP, COIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, rat, monkey
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14708

  Product name: Recombinant human PTPIP51 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-141 aa of BC008970

  Sequence: ESDNERDSDKESEDGEDEVSCETVKMGRKDSLDLEEEAASGASSALEAGGSSGLEDVLPLLQQADELHRGDEQGKREGFQLLLNNKLVYGSRQDFLWRLARAYSDMCELTEEVSEKKSYALDGKEEAEAALEKGDESADCH

• Full Name: family with sequence similarity 82, member A2
• Calculated Molecular Weight: 470 aa, 52 kDa
• Observed Molecular Weight: 52-60 kDa
• GenBank Accession Number: BC008970
• Gene Symbol: PTPIP51
• Gene ID (NCBI): 55177
• RRID: AB_10695187
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96TC7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Protein tyrosine phosphatase-interacting protein 51 (PTPIP51),also known as RMDN3, is a mitochondrial membrane-anchored protein that interacts with ER membrane-bound VAPB. The VAPB-PTPIP51 interaction impacts on intracellular Ca2+ handling (PMID: 22131369, 28345618). PTPIP51 participates in multiple cellular processes, and dysfunction of PTPIP51 is implicated in diseases such as cancer and neurodegenerative disorders (PMID: 28345618). The known initiation sites in the Ptpip51 gene would lead to molecular protein masses of 52, 38 and 30 kDa (PMID: 18854601,19844996).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Metab; A High-Density Human Mitochondrial Proximity Interaction Network.; Authors - Hana Antonicka
monkey	WB,IF	Nat Cell Biol; MIROs and DRP1 drive mitochondrial-derived vesicle biogenesis and promote quality control.; Authors - Tim König ; KD Validated
human	COIP	Mol Cell; The ER-Localized Transmembrane Protein EPG-3/VMP1 Regulates SERCA Activity to Control ER-Isolation Membrane Contacts for Autophagosome Formation.; Authors - Yan G Zhao
human	WB	J Cell Biol; Atlastin 2/3 regulate ER targeting of the ULK1 complex to initiate autophagy.; Authors - Nan Liu
human	WB,CoIP	EMBO Rep; Nup358 restricts ER-mitochondria connectivity by modulating mTORC2/Akt/GSK3β signalling; Authors - Misha Kalarikkal ; KD Validated
mouse		EMBO Rep; Peri-mitochondrial actin filaments inhibit Parkin assembly by disrupting ER-mitochondria contacts; Authors - Tak Shun Fung

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Tom (Verified Customer) (03-23-2021)

Cos7 cells fixed in 4% PFA, perm in 0.1% Triton then blocked in 1% BSA. Mitochondria also labelled with TOMM20. Cells incubated with primary antibody (1/100) for 1 hour.

• Applications: Immunofluorescence
• Primary Antibody Dilution: 1/100
• Cell Tissue Type: Cos7

PTPIP51 Antibody Immunofluorescence validation (1/100 dilution) in Cos7 (Cat no:20641-1-AP)