PTPLAD1 Polyclonal antibody

PTPLAD1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 28572-1-AP

Publications (4)

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

B IND1, BIND1, Butyrate induced protein 1, FLJ90376, HACD3

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHC

WB analysis using 28572-1-AP
Human placenta tissue were subjected to SDS PAGE followed by western blot with 28572-1-AP (PTPLAD1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human breast cancer using 28572-1-AP
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 28572-1-AP (PTPLAD1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human pancreas cancer using 28572-1-AP
Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 28572-1-AP (PTPLAD1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human placenta using 28572-1-AP
Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 28572-1-AP (PTPLAD1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse kidney using 28572-1-AP
Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 28572-1-AP (PTPLAD1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse pancreas using 28572-1-AP
Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 28572-1-AP (PTPLAD1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat kidney using 28572-1-AP
Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 28572-1-AP (PTPLAD1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat pancreas using 28572-1-AP
Immunohistochemical analysis of paraffin-embedded rat pancreas tissue slide using 28572-1-AP (PTPLAD1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human breast cancer using 28572-1-AP
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 28572-1-AP (PTPLAD1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human liver cancer using 28572-1-AP
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 28572-1-AP (PTPLAD1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human liver cancer using 28572-1-AP
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 28572-1-AP (PTPLAD1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human liver cancer using 28572-1-AP
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 28572-1-AP (PTPLAD1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human liver cancer using 28572-1-AP
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 28572-1-AP (PTPLAD1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for PTPLAD1 in ?

Overview

Tested Applications
Product Information
Publications (4)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	human placenta tissue
Positive IHC detected in	human breast cancer tissue, rat pancreas tissue, mouse pancreas tissue, human pancreas cancer tissue, mouse kidney tissue, rat kidney tissue, human liver cancer tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:500-1:2000
Immunohistochemistry (IHC)	IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

28572-1-AP targets PTPLAD1 in WB, IHC, ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Cited Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag29557 Product name: Recombinant human PTPLAD1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-149 aa of NM_016395 Sequence: MENQVLTPHVYWAQRHRELYLRVELSDVQNPAISITENVLHFKAQGHGAKGDNVYEFHLEFLDLVKPEPVYKLTQRQVNITVQKKVSQWWERLTKQEKRPLFLAPDFDRWLDESDAEMELRAKEEERLNKLRLESEGSPETLTNLRKGY Predict reactive species
Full Name	protein tyrosine phosphatase-like A domain containing 1
Calculated Molecular Weight	43 kDa
Observed Molecular Weight	43 kDa
GenBank Accession Number	NM_016395
Gene Symbol	PTPLAD1
Gene ID (NCBI)	51495
RRID	AB_2881172
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q9P035
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IHC protocol for PTPLAD1 antibody 28572-1-AP	Download protocol
WB protocol for PTPLAD1 antibody 28572-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The PTPLAD1 Polyclonal antibody (Cat# 28572-1-AP) has 4 citations across Nature Communications, International Journal of Biological Sciences, Life Sciences, and Viruses. Research fields include viral replication (orthoflavivirus UFMylation, influenza A virus), epithelial-mesenchymal transition in colorectal cancer, and CRISPR-based gene screening in lung adenocarcinoma. All citations used WB on human samples.

Species	Application	Title
human	WB	Nat Commun A genus-wide interaction atlas across NS4B orthologues identifies a conserved role for UFMylation in orthoflavivirus replication. Authors - Sreejith Rajasekharan View Article
human	WB	Int J Biol Sci PTPLAD1 Regulates PHB-Raf Interaction to Orchestrate Epithelial-Mesenchymal and Mitofusion-Fission Transitions in Colorectal Cancer Authors - Zi-Jia Huang KD Validated View Article
human	WB	Life Sci Membrane protein-focused CRISPR screen identifies ATP2A2 as a druggable transcriptional co-regulator of CCND1 (cyclin D1) in lung adenocarcinoma. Authors - Yu Meng View Article
human	WB	Viruses HACD3 Prevents PB1 from Autophagic Degradation to Facilitate the Replication of Influenza A Virus Authors - Qibing Li View Article