Use Able AI chat for product recommendations

PTPMT1 Recombinant monoclonal antibody, PBS Only

PTPMT1 Uni-rAb® Recombinant Antibody for WB, Indirect ELISA

Cat No. 87082-1-PBS
Clone No.252195D2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

DUSP23, EC:3.1.3.16, EC:3.1.3.48, EC:3.1.3.27, MOSP, Phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

87082-1-PBS targets PTPMT1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag2063

Product name: Recombinant human PTPMT1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-201 aa of BC020242

Sequence: MAATALLEAGLARVLFYPTLLYTLFRGKVPGRAHRDWYHRIDPTVLLGALPLRSLTRQLVQDENVRGVITMNEEYETRFLCNSSQEWKRLGVEQLRLSTVDMTGIPTLDNLQKGVQFALKYQSLGQCVYVHCKAGRSRSATMVAAYLIQVHKWSPEEAVRAIAKIRSYIHIRPGQLDVLKEFHKQITARATKDGTFVISKT

Predict reactive species
Full Name protein tyrosine phosphatase, mitochondrial 1
Calculated Molecular Weight 201 aa, 23 kDa
Observed Molecular Weight16 kDa
GenBank Accession NumberBC020242
Gene Symbol PTPMT1
Gene ID (NCBI) 114971
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ8WUK0
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Protein Tyrosine Phosphatase localized to the Mitochondrial 1 (PTPMT1) is a highly conserved, dual-specific phosphatase that resides on the matrix-facing side of the inner mitochondrial membrane (IMM). PTPMT1 is a mitochondrial phosphatase and a vital regulator of mitochondrial activities. Current work points to roles for PTPMT1 in the regulation of mitochondrial respiration, dynamics, and ultrastructure through the modulation of pyruvate importation, the tuning of TCA cycle activity, and the synthesis of cardiolipin. PTPMT1 is highly expressed in pancreatic b cells, whose mitochondria have the important function of coupling glucose metabolism to the secretion of insulin. (PMID: 16337125, PMID: 16061174, PMID: 33335799)

Loading...
||
New chat

Able

正在加载,请稍候...