PTPMT1 Recombinant monoclonal antibody

• 

  WB analysis using 87082-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87082-1-RR (PTPMT1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  Affinity and Kinetic Characterization of 87082-1-RR

  Biolayer interferometry (BLl) kinetic assays of 87082-1-RR against Human PTPMT1 were performed. The affinity constant is below 1 pM.

PTPMT1 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 87082-1-RR

Clone No.252195D2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

DUSP23, EC:3.1.3.16, EC:3.1.3.48, EC:3.1.3.27, MOSP, Phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1

---

Tested Applications

• Positive WB detected in: A549 cells, PANC-1 cells, HEK-293 cells, HepG2 cells, HuH-7 cells, mouse pancreas tissue, rat pancreas tissue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87082-1-RR targets PTPMT1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag2063

  Product name: Recombinant human PTPMT1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-201 aa of BC020242

  Sequence: MAATALLEAGLARVLFYPTLLYTLFRGKVPGRAHRDWYHRIDPTVLLGALPLRSLTRQLVQDENVRGVITMNEEYETRFLCNSSQEWKRLGVEQLRLSTVDMTGIPTLDNLQKGVQFALKYQSLGQCVYVHCKAGRSRSATMVAAYLIQVHKWSPEEAVRAIAKIRSYIHIRPGQLDVLKEFHKQITARATKDGTFVISKT

• Full Name: protein tyrosine phosphatase, mitochondrial 1
• Calculated Molecular Weight: 201 aa, 23 kDa
• Observed Molecular Weight: 16 kDa
• GenBank Accession Number: BC020242
• Gene Symbol: PTPMT1
• Gene ID (NCBI): 114971
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8WUK0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Protein Tyrosine Phosphatase localized to the Mitochondrial 1 (PTPMT1) is a highly conserved, dual-specific phosphatase that resides on the matrix-facing side of the inner mitochondrial membrane (IMM). PTPMT1 is a mitochondrial phosphatase and a vital regulator of mitochondrial activities. Current work points to roles for PTPMT1 in the regulation of mitochondrial respiration, dynamics, and ultrastructure through the modulation of pyruvate importation, the tuning of TCA cycle activity, and the synthesis of cardiolipin. PTPMT1 is highly expressed in pancreatic b cells, whose mitochondria have the important function of coupling glucose metabolism to the secretion of insulin. (PMID: 16337125, PMID: 16061174, PMID: 33335799)