• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated PTPN6 Polyclonal antibody

PTPN6 Polyclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-24546

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, FC (Intra)

SHP1, Protein-tyrosine phosphatase 1C, HPTP1C, Hematopoietic cell protein-tyrosine phosphatase, HCPH

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inMCF-7 cells
Positive FC (Intra) detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-24546 targets PTPN6 in IF/ICC, FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag21415

Product name: Recombinant human PTPN6 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 506-598 aa of BC002523

Sequence: QYKFIYVAIAQFIETTKKKLEVLQSQKGQESEYGNITYPPAMKNAHAKASRTSSKHKEDVYENLHTKNKREEKVKKQRSADKEKSKGSLKRK

Predict reactive species
Full Name protein tyrosine phosphatase, non-receptor type 6
Calculated Molecular Weight 597 aa, 68 kDa
Observed Molecular Weight 63 kDa
GenBank Accession NumberBC002523
Gene Symbol PTPN6
Gene ID (NCBI) 5777
RRIDAB_3084082
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP29350
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

PTPN6(Tyrosine-protein phosphatase non-receptor type 6) is also named as HCP, PTP1C and belongs to the protein-tyrosine phosphatase family. It regulates muscle INS action in a cell-autonomous manner, further suggesting that the PTPase negatively modulates INS action through down-regulation of both INS signaling to AKT1 and SLC2A4 translocation, as well as SLC2A4 expression(PMID:21952243). It has 4 isoforms produced by alternative splicing.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 PTPN6 antibody CL488-24546Download protocol
FC protocol for CL Plus 488 PTPN6 antibody CL488-24546Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...