Product Information
80670-2-PBS targets PTPN6/SHP1 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag21415 Product name: Recombinant human PTPN6 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 506-598 aa of BC002523 Sequence: QYKFIYVAIAQFIETTKKKLEVLQSQKGQESEYGNITYPPAMKNAHAKASRTSSKHKEDVYENLHTKNKREEKVKKQRSADKEKSKGSLKRK Predict reactive species |
| Full Name | protein tyrosine phosphatase, non-receptor type 6 |
| Calculated Molecular Weight | 597 aa, 68 kDa |
| Observed Molecular Weight | 68 kDa |
| GenBank Accession Number | BC002523 |
| Gene Symbol | PTPN6/SHP1 |
| Gene ID (NCBI) | 5777 |
| RRID | AB_3743350 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P29350 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
PTPN6(Tyrosine-protein phosphatase non-receptor type 6) is also named as HCP, PTP1C and belongs to the protein-tyrosine phosphatase family. It regulates muscle INS action in a cell-autonomous manner, further suggesting that the PTPase negatively modulates INS action through down-regulation of both INS signaling to AKT1 and SLC2A4 translocation, as well as SLC2A4 expression(PMID:21952243). It has 4 isoforms produced by alternative splicing.



