PTPN6/SHP1 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• PTPN6/SHP1 Recombinant monoclonal antibody (80670-2-RR)

• 

  WB analysis using 80670-2-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 80670-2-RR (PTPN6 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

PTPN6/SHP1 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 80670-2-RR

Clone No.252458C5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

PTPN6, SHP1, EC:3.1.3.48, HCP, HCPH

---

Tested Applications

• Positive WB detected in: HL-60 cells, Raji cells, THP-1 cells, Jurkat cells, mouse spleen tissue, rat spleen tissue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

80670-2-RR targets PTPN6/SHP1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag21415

  Product name: Recombinant human PTPN6 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 506-598 aa of BC002523

  Sequence: QYKFIYVAIAQFIETTKKKLEVLQSQKGQESEYGNITYPPAMKNAHAKASRTSSKHKEDVYENLHTKNKREEKVKKQRSADKEKSKGSLKRK

• Full Name: protein tyrosine phosphatase, non-receptor type 6
• Calculated Molecular Weight: 597 aa, 68 kDa
• Observed Molecular Weight: 63 kDa
• GenBank Accession Number: BC002523
• Gene Symbol: PTPN6/SHP1
• Gene ID (NCBI): 5777
• RRID: AB_3743350
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P29350
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PTPN6(Tyrosine-protein phosphatase non-receptor type 6) is also named as HCP, PTP1C and belongs to the protein-tyrosine phosphatase family. It regulates muscle INS action in a cell-autonomous manner, further suggesting that the PTPase negatively modulates INS action through down-regulation of both INS signaling to AKT1 and SLC2A4 translocation, as well as SLC2A4 expression(PMID:21952243). It has 4 isoforms produced by alternative splicing.