PTPRD Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PTPRD Polyclonal antibody, PBS Only (27941-1-PBS)

• 

  WB analysis using 27941-1-AP (same clone as 27941-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27941-1-AP (PTPRD antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27941-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 27941-1-AP (same clone as 27941-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27941-1-AP (PTPRD antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27941-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 27941-1-AP (same clone as 27941-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 27941-1-AP (PTPRD antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27941-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 27941-1-AP (same clone as 27941-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 27941-1-AP (PTPRD antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27941-1-PBS in a different storage buffer formulation.

PTPRD Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 27941-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

PTPD, Protein-tyrosine phosphatase delta, HPTPD, HPTP DELTA, HPTP

---

Product Information

27941-1-PBS targets PTPRD in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27689

  Product name: Recombinant human PTPRD protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1089-1225 aa of BC106714

  Sequence: GNSAGGLQHRVTAKTAPDVLRTKPAFIGKTNLDGMITVQLPEVPANENIKGYYIIIVPLKKSRGKFIKPWESPDEMELDELLKEISRKRRSIRYGREVELKPYIAAHFDVLPTEFTLGDDKHYGGFTNKQLQSGQEY

• Full Name: protein tyrosine phosphatase, receptor type, D
• Calculated Molecular Weight: 1912 aa, 215 kDa
• Observed Molecular Weight: 75 kDa, 175 kDa
• GenBank Accession Number: BC106714
• Gene Symbol: PTPRD
• Gene ID (NCBI): 5789
• RRID: AB_3086013
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P23468
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PTPRD is a receptor-type protein tyrosine phosphatase that plays significant roles in various biological processes, including cell adhesion, synaptic function, and signal transduction. PTPRD is highly expressed in the brain, followed by the kidney, ovary, placenta, and intestine. Within the brain, it is found in specific regions, suggesting a role in neurological functions. PTPRD has emerged as a potential therapeutic target for various brain phenotypes and disorders. Its genetic variations have been associated with nervous system phenotypes, and the discovery of the first small molecule inhibitor of PTPRD phosphatase has opened new avenues for therapeutic intervention in addiction and possibly other PTPRD-associated disorders. Additionally, PTPRD is considered a tumor-suppressor gene that is down-regulated in hepatocellular carcinoma, suggesting its role in cancer progression and potential as a therapeutic target. The protein can recognize 175 kDa full length and 75 kDa mature cleavage product (PMID: 19074898, PMID: 25113440).