PTPRM/RPTPmu Polyclonal antibody

• 

  WB analysis using 30763-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30763-1-AP (PTPRM antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 30763-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30763-1-AP (PTPRM antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse kidney using 30763-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 30763-1-AP (PTPRM/RPTPmu antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

PTPRM/RPTPmu Polyclonal Antibody for WB, ELISA

Cat No. 30763-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, ELISA

Synonyms

PTPRM, EC:3.1.3.48, hR PTPu, Protein-tyrosine phosphatase mu, PTPRL1

---

Tested Applications

• Positive WB detected in: MCF-7 cells, MDA-MB-231 cells, U-87 MG cells, rat eye tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

30763-1-AP targets PTPRM/RPTPmu in WB, ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag33475

  Product name: Recombinant human PTPRM protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 765-880 aa of NM_002845

  Sequence: KKRKLAKKRKETMSSTRQEMTVMVNSMDKSYAEQGTNCDEAFSFMDTHNLNGRSVSSPSSFTMKTNTLSTSVPNSYYPDETHTMASDTSSLVQSHTYKKREPADVPYQTGQLHPAI

• Full Name: protein tyrosine phosphatase, receptor type, M
• Calculated Molecular Weight: 164KD
• Observed Molecular Weight: 80 kDa, 100 kDa, 200 kDa
• GenBank Accession Number: NM_002845
• Gene Symbol: PTPRM
• Gene ID (NCBI): 5797
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P28827
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PTPRM, also known as protein tyrosine phosphatase receptor type M or RPTPmu, is a protein with a molecular weight of approximately 155 kDa. It is a receptor-type tyrosine phosphatase involved in cell-cell adhesion, migration, and signaling. It exists in two forms, either a full-length 200 kDa form or as two noncovalently associated fragments of 100 kDa each.Additional unidentified serine proteases cleave PTPμ in GBM cells to yield smaller extracellular fragments with MWs of 78 and 55 kDa (PMID: 25223585).