PTPRM/RPTPmu Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PTPRM/RPTPmu Polyclonal antibody, PBS Only (30763-1-PBS)

• 

  WB analysis using 30763-1-AP (same clone as 30763-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30763-1-AP (PTPRM antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30763-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 30763-1-AP (same clone as 30763-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30763-1-AP (PTPRM antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30763-1-PBS in a different storage buffer formulation.

PTPRM/RPTPmu Polyclonal Antibody for WB, Indirect ELISA

Cat No. 30763-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, Indirect ELISA

Synonyms

PTPRM, EC:3.1.3.48, hR PTPu, Protein-tyrosine phosphatase mu, PTPRL1

---

Product Information

30763-1-PBS targets PTPRM/RPTPmu in WB, Indirect ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag33475

  Product name: Recombinant human PTPRM protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 765-880 aa of NM_002845

  Sequence: KKRKLAKKRKETMSSTRQEMTVMVNSMDKSYAEQGTNCDEAFSFMDTHNLNGRSVSSPSSFTMKTNTLSTSVPNSYYPDETHTMASDTSSLVQSHTYKKREPADVPYQTGQLHPAI

• Full Name: protein tyrosine phosphatase, receptor type, M
• Calculated Molecular Weight: 164KD
• Observed Molecular Weight: 80 kDa, 100 kDa, 200 kDa
• GenBank Accession Number: NM_002845
• Gene Symbol: PTPRM
• Gene ID (NCBI): 5797
• RRID: AB_3742370
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P28827
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PTPRM, also known as protein tyrosine phosphatase receptor type M or RPTPmu, is a protein with a molecular weight of approximately 155 kDa. It is a receptor-type tyrosine phosphatase involved in cell-cell adhesion, migration, and signaling. It exists in two forms, either a full-length 200 kDa form or as two noncovalently associated fragments of 100 kDa each.Additional unidentified serine proteases cleave PTPμ in GBM cells to yield smaller extracellular fragments with MWs of 78 and 55 kDa (PMID: 25223585).