CoraLite®594-conjugated PTPRO Monoclonal antibody

PTPRO Monoclonal Antibody for
Cat No. CL594-67000
Clone No.2F2B4

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, pig

Applications

2F2B4, EC:3.1.3.48, GLEPP1, PTP U2, PTPase U2

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite®594
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

CL594-67000 targets PTPRO in applications and shows reactivity with human, mouse, pig samples.

Tested Reactivity human, mouse, pig
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag8284

Product name: Recombinant human PTPRO protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 298-597 aa of BC035960

Sequence: YWWDSASAAPESEDEFVSVLPMEYENNSTLSETEKSTSGSFSFFPVQMILTWLPPKPPTAFDGFHIHIEREENFTEYLMVDEEAHEFVAELKEPGKYKLSVTTFSSSGSCETRKSQSAKSLSFYISPSGEWIEELTEKPQHVSVHVLSSTTALMSWTSSQENYNSTIVSVVSLTCQKQKESQRLEKQYCTQVNSSKPIIENLVPGAQYQVVIYLRKGPLIGPPSDPVTFAIVPTGIKDLMLYPLGPTAVVLSWTRPYLGVFRKYVVEMFYFNPATMTSEWTTYYEIAATVSLTASVVIFP

Predict reactive species
Full Name protein tyrosine phosphatase, receptor type, O
Calculated Molecular Weight 138 kDa
Observed Molecular Weight 160 kDa, 180-220 kDa
GenBank Accession NumberBC035960
Gene Symbol PTPRO
Gene ID (NCBI) 5800
RRIDAB_2920069
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ16827
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

PTPRO(receptor-type tyrosine-protein phosphatase O) is also named as GLEPP1, PTPU2 and belongs to the protein-tyrosine phosphatase family. The protein is a receptor-like membrane protein tyrosine phosphatase expressed at the apical membrane of the podocyte foot processes in the kidney(PMID:21722858). The 1,159-amino acid predicted mature protein contains a large extracellular domain, a single transmembrane domain, and a single intracellular PTPase domain. Defects in PTPRO are the cause of nephrotic syndrome type 6 (NPHS6). In reducing conditions, PTPRO can form a smear from 180 to 220 kDa; In non-reducing conditions, a band appeares around 350 kDa, which likely represents the dimeric form of full-length PTPRO (PMID: 19573017).

Protocols

Product Specific Protocols
IF protocol for CL594 PTPRO antibody CL594-67000Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...